KLF12 Antibody (3E4) Summary
| Immunogen |
KLF12 (NP_009180, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNIHMKRKTIKNINTFENRMLMLDGMPAVRVKTELLESEQGSPNVHNYPDMEAVPLLLNNVKGEPPEDSLSVDHFQTQTEPVDLSINKAR |
| Specificity |
KLF12 - Kruppel-like factor 12 |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
KLF12 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for KLF12 Antibody (3E4)
Background
Activator protein-2 alpha (AP-2 alpha) is a developmentally-regulated transcription factor and important regulator of gene expression during vertebrate development and carcinogenesis. The protein encoded by this gene is a member of the Kruppel-like zinc finger protein family and can repress expression of the AP-2 alpha gene by binding to a specific site in the AP-2 alpha gene promoter. Repression by the encoded protein requires binding with a corepressor, CtBP1. Two transcript variants encoding different isoforms have been found for this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ch, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC, KO, Simple Western, WB
Species: Mu
Applications: ChIP, ICC, IHC, WB
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Pm
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu, Rt
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Publications for KLF12 Antibody (H00011278-M01) (0)
There are no publications for KLF12 Antibody (H00011278-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for KLF12 Antibody (H00011278-M01) (0)
There are no reviews for KLF12 Antibody (H00011278-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for KLF12 Antibody (H00011278-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KLF12 Products
Research Areas for KLF12 Antibody (H00011278-M01)
Find related products by research area.
|
Blogs on KLF12