KLF12 Antibody (3E4)

Western Blot: KLF12 Antibody (3E4) [H00011278-M01] - Analysis of KLF12 expression in transfected 293T cell line by KLF12 monoclonal antibody (M01), clone 3E4.Lane 1: KLF12 transfected lysate(44.2 KDa).Lane 2: Non-transfected lysate.

Product Discontinued

KLF12 Antibody (3E4) Summary

• Immunogen: KLF12 (NP_009180, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNIHMKRKTIKNINTFENRMLMLDGMPAVRVKTELLESEQGSPNVHNYPDMEAVPLLLNNVKGEPPEDSLSVDHFQTQTEPVDLSINKAR
• Specificity: KLF12 - Kruppel-like factor 12
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: KLF12
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KLF12 Antibody (3E4)

• AP-2rep transcription factor
• AP2REP
• AP-2rep
• AP2REPAP-2 repressor
• HSPC122
• KLF12 zinc finger transcriptional repressor
• KLF12
• Krueppel-like factor 12
• Kruppel-like factor 12
• Transcriptional repressor AP-2rep

Background

Activator protein-2 alpha (AP-2 alpha) is a developmentally-regulated transcription factor and important regulator of gene expression during vertebrate development and carcinogenesis. The protein encoded by this gene is a member of the Kruppel-like zinc finger protein family and can repress expression of the AP-2 alpha gene by binding to a specific site in the AP-2 alpha gene promoter. Repression by the encoded protein requires binding with a corepressor, CtBP1. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KLF12
• Entrez:
  • 11278(Human)
• OMIM:
  • 607531(Human)
• Uniprot:
  • NP_009180(Human)