KLF12 Antibody (3D2)

Western Blot: KLF12 Antibody (3D2) [H00011278-M04] - Analysis of KLF12 expression in transfected 293T cell line by KLF12 monoclonal antibody (M04), clone 3D2. Lane 1: KLF12 transfected lysatE (44.2 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

KLF12 Antibody (3D2) Summary

• Immunogen: KLF12 (NP_009180, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNIHMKRKTIKNINTFENRMLMLDGMPAVRVKTELLESEQGSPNVHNYPDMEAVPLLLNNVKGEPPEDSLSVDHFQTQTEPVDLSINKAR
• Specificity: KLF12 - Kruppel-like factor 12 (3D2)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: KLF12
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KLF12 Antibody (3D2)

• AP-2rep transcription factor
• AP2REP
• AP-2rep
• AP2REPAP-2 repressor
• HSPC122
• KLF12 zinc finger transcriptional repressor
• KLF12
• Krueppel-like factor 12
• Kruppel-like factor 12
• Transcriptional repressor AP-2rep

Background

Activator protein-2 alpha (AP-2 alpha) is a developmentally-regulated transcription factor and important regulator of gene expression during vertebrate development and carcinogenesis. The protein encoded by this gene is a member of the Kruppel-like zinc finger protein family and can repress expression of the AP-2 alpha gene by binding to a specific site in the AP-2 alpha gene promoter. Repression by the encoded protein requires binding with a corepressor, CtBP1. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KLF12
• Entrez:
  • 11278(Human)
• Uniprot:
  • NP_009180(Human)