KLF11 Antibody (10D8) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related KLF11 Primary Antibodies

Order Details


    • Catalog Number
      H00008462-M03PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

KLF11 Antibody (10D8) [PE] Summary

Immunogen
KLF11 (NP_003588 404 a.a. - 512 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TYFKSSHLKAHLRTHTGEKPFNCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIPGWQAEVGKLNRIASAESPGSPLVSMPASA
Specificity
KLF11 - Kruppel-like factor 11 (10D8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KLF11
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KLF11 Antibody (10D8) [PE]

  • FKLFFKLF1
  • Krueppel-like factor 11
  • Kruppel-like factor 11
  • MODY7TGFB-inducible early growth response protein 2
  • TIEG-2
  • TIEG2TGFB inducible early growth response 2
  • Tieg3
  • Transforming growth factor-beta-inducible early growth response protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00007071-M15
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NB200-107
Species: Hu, Mu
Applications: WB, ELISA, Flow, GS, IHC, IHC-Fr, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP2-37380
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP1-87493
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB2029
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-48937
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-46198
Species: Hu
Applications: WB, IHC
MAB7446
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-20231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF3158
Species: Mu
Applications: WB, ChIP, ICC
NBP2-45511
Species: Hu
Applications: WB, IHC
AF3758
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NB100-1051
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, PEP-ELISA

Publications for KLF11 Antibody (H00008462-M03PE) (0)

There are no publications for KLF11 Antibody (H00008462-M03PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLF11 Antibody (H00008462-M03PE) (0)

There are no reviews for KLF11 Antibody (H00008462-M03PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KLF11 Antibody (H00008462-M03PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KLF11 Products

Bioinformatics Tool for KLF11 Antibody (H00008462-M03PE)

Discover related pathways, diseases and genes to KLF11 Antibody (H00008462-M03PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLF11 Antibody (H00008462-M03PE)

Discover more about diseases related to KLF11 Antibody (H00008462-M03PE).
 

Pathways for KLF11 Antibody (H00008462-M03PE)

View related products by pathway.

PTMs for KLF11 Antibody (H00008462-M03PE)

Learn more about PTMs related to KLF11 Antibody (H00008462-M03PE).
 

Research Areas for KLF11 Antibody (H00008462-M03PE)

Find related products by research area.

Blogs on KLF11

There are no specific blogs for KLF11, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLF11 Antibody (10D8) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol KLF11