Kirrel2/NEPH3 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related Kirrel2/NEPH3 Peptides and Proteins

Order Details


    • Catalog Number
      NBP2-58944PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Kirrel2/NEPH3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to Kirrel2/NEPH3.

Source: E. coli

Amino Acid Sequence: PTFYDFNPHLGMVPPCRLYRARAGYLTTPHPRAFTSYIKPTSFGPPDLAPGTPPFPYAAFPTPSHPRLQTH

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KIRREL2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-58944 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Kirrel2/NEPH3 Recombinant Protein Antigen

  • DKFZp564A1164
  • Filtrin
  • FILTRINkin of IRRE-like protein 2
  • kin of IRRE like 2 (Drosophila)
  • Kin of irregular chiasm-like protein 2
  • Kirrel2
  • MGC15718
  • NEPH3
  • NEPH3Nephrin-like protein 3
  • nephrin-like 3
  • nephrin-like gene 1
  • NLG1
  • NLG1kin of irregular chiasm-like 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3159
Species: Mu
Applications: WB, IHC
AF4340
Species: Hu, Rt
Applications: WB, IHC
AF4910
Species: Hu, Mu, Rt
Applications: WB
NBP2-33570
Species: Hu
Applications: IHC, IHC-P
NBP2-41299
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC
AF4524
Species: Rt
Applications: WB
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-84565
Species: Hu
Applications: IHC, IHC-P
H00000081-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NBP1-92683
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-90626
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP2-20460
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
NBP2-25200
Species: Hu
Applications: WB, B/N, Flow, IHC, IHC-Fr

Publications for Kirrel2/NEPH3 Recombinant Protein Antigen (NBP2-58944PEP) (0)

There are no publications for Kirrel2/NEPH3 Recombinant Protein Antigen (NBP2-58944PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kirrel2/NEPH3 Recombinant Protein Antigen (NBP2-58944PEP) (0)

There are no reviews for Kirrel2/NEPH3 Recombinant Protein Antigen (NBP2-58944PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Kirrel2/NEPH3 Recombinant Protein Antigen (NBP2-58944PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Kirrel2/NEPH3 Recombinant Protein Antigen (NBP2-58944PEP)

Discover related pathways, diseases and genes to Kirrel2/NEPH3 Recombinant Protein Antigen (NBP2-58944PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kirrel2/NEPH3 Recombinant Protein Antigen (NBP2-58944PEP)

Discover more about diseases related to Kirrel2/NEPH3 Recombinant Protein Antigen (NBP2-58944PEP).
 

Pathways for Kirrel2/NEPH3 Recombinant Protein Antigen (NBP2-58944PEP)

View related products by pathway.

PTMs for Kirrel2/NEPH3 Recombinant Protein Antigen (NBP2-58944PEP)

Learn more about PTMs related to Kirrel2/NEPH3 Recombinant Protein Antigen (NBP2-58944PEP).

Blogs on Kirrel2/NEPH3

There are no specific blogs for Kirrel2/NEPH3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Kirrel2/NEPH3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KIRREL2
Entrez