Kinesin 5A Antibody


Western Blot: Kinesin 5A Antibody [NBP1-52957] - Antibody Titration: 0.2-1 ug/ml Positive Control: Human brain
Immunohistochemistry: Kinesin 5A Antibody [NBP1-52957] - Paraffin Embedded Tissue: Human Lung cell Cellular Data: bronchiole epithelium of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X
Immunohistochemistry: Kinesin 5A Antibody [NBP1-52957] - Paraffin Embedded Tissue: Human Lung cell Cellular Data: bronchiole epithelium of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X

Product Details

Product Discontinued
View other related Kinesin 5A Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Kinesin 5A Antibody Summary

Synthetic peptides corresponding to KIF5A (kinesin family member 5A) The peptide sequence was selected from the middle region of KIF5A. Peptide sequence LEESYDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVKKALELQMESH.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against KIF5A and was validated on Western Blot and immunohistochemistry-P
Theoretical MW
117 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Kinesin 5A Antibody

  • D12S1889
  • KIF5A variant protein
  • kinesin family member 5A
  • kinesin heavy chain isoform 5A
  • Kinesin heavy chain neuron-specific 1
  • kinesin, heavy chain, neuron-specific
  • MY050
  • Neuronal kinesin heavy chain
  • NKHC1
  • NKHCspastic paraplegia 10 (autosomal dominant)
  • SPG10


KIF5A is a member of the kinesin family of proteins. Members of this family are part of a multisubunit complex that functions as a microtubule motor in intracellular organelle transport. Mutations in this gene cause autosomal dominant spastic paraplegia 10.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Ca
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Dr
Applications: WB, ICC/IF, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Kinesin 5A Antibody (NBP1-52957) (0)

There are no publications for Kinesin 5A Antibody (NBP1-52957).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kinesin 5A Antibody (NBP1-52957) (0)

There are no reviews for Kinesin 5A Antibody (NBP1-52957). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kinesin 5A Antibody (NBP1-52957) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Kinesin 5A Products

Bioinformatics Tool for Kinesin 5A Antibody (NBP1-52957)

Discover related pathways, diseases and genes to Kinesin 5A Antibody (NBP1-52957). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kinesin 5A Antibody (NBP1-52957)

Discover more about diseases related to Kinesin 5A Antibody (NBP1-52957).

Pathways for Kinesin 5A Antibody (NBP1-52957)

View related products by pathway.

PTMs for Kinesin 5A Antibody (NBP1-52957)

Learn more about PTMs related to Kinesin 5A Antibody (NBP1-52957).

Research Areas for Kinesin 5A Antibody (NBP1-52957)

Find related products by research area.

Blogs on Kinesin 5A

There are no specific blogs for Kinesin 5A, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Kinesin 5A Antibody and receive a gift card or discount.


Gene Symbol KIF5A