KIF2C Antibody

Images

 
Western Blot: KIF2C Antibody [NBP1-82870] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: KIF2C Antibody [NBP1-82870] - Staining of human cell line U-2 OS shows positivity in cytoplasm and cytoskeleton (intermediate filaments).
Immunohistochemistry-Paraffin: KIF2C Antibody [NBP1-82870] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Product Discontinued
View other related KIF2C Primary Antibodies

Order Details


    • Catalog Number
      NBP1-82870
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

KIF2C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RYADRVKELSPHSGPSGEQLIQMETEEMEACSNGALIPGNLSKEEEELSSQMSSFNEAMTQIRELEEKAMEELKEIIQQGPDWLELSEMTEQPDYDLETFVNKAESALAQQAKHFSALR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIF2C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Publications
Read Publication using NBP1-82870.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (84%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KIF2C Antibody

  • kinesin family member 2C
  • kinesin-like 6 (mitotic centromere-associated kinesin)
  • Kinesin-like protein 6
  • kinesin-like protein KIF2C
  • MCAKKNSL6kinesin-like 6
  • Mitotic centromere-associated kinesin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NB500-181
Species: Hu, Mu, Rt, Po, Dr
Applications: WB, ICC/IF, IP
NB500-180
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, ICC/IF, IP
NBP1-82875
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84928
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-182
Species: Hu, Mu, Rt, Ma
Applications: WB, ICC/IF, IP
NBP2-33374
Species: Hu
Applications: WB, IHC, IHC-P
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NBP2-00714
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-37471
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-353
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
H00009167-B02P
Species: Hu
Applications: WB, ELISA
H00056899-P01
Species: Hu
NBP1-89951
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82870
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for KIF2C Antibody (NBP1-82870)(1)

Reviews for KIF2C Antibody (NBP1-82870) (0)

There are no reviews for KIF2C Antibody (NBP1-82870). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KIF2C Antibody (NBP1-82870) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KIF2C Products

Bioinformatics Tool for KIF2C Antibody (NBP1-82870)

Discover related pathways, diseases and genes to KIF2C Antibody (NBP1-82870). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIF2C Antibody (NBP1-82870)

Discover more about diseases related to KIF2C Antibody (NBP1-82870).
 

Pathways for KIF2C Antibody (NBP1-82870)

View related products by pathway.

PTMs for KIF2C Antibody (NBP1-82870)

Learn more about PTMs related to KIF2C Antibody (NBP1-82870).
 

Research Areas for KIF2C Antibody (NBP1-82870)

Find related products by research area.

Blogs on KIF2C

There are no specific blogs for KIF2C, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIF2C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF2C