KIF2B Antibody


Western Blot: KIF2B Antibody [NBP1-70590] - Human Thymus lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related KIF2B Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

KIF2B Antibody Summary

Synthetic peptides corresponding to KIF2B(kinesin family member 2B) The peptide sequence was selected from the middle region of KIF2B. Peptide sequence DCSKGIYALVAQDVFLLLRNSTYEKLDLKVYGTFFEIYGGKVYDLLNWKK.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against KIF2B and was validated on Western blot.
Theoretical MW
76 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KIF2B Antibody

  • FLJ53902
  • kinesin family member 2B
  • kinesin protein
  • kinesin-like protein KIF2B


KIF2B is the plus end-directed microtubule-dependent motor required for spindle assembly and chromosome movement. KIF2B has microtubule depolymerization activity.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, ICC/IF, IP
Species: Hu, Ca
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IP, PLA, ICC, IF
Species: Hu, Mu, Rt, Ca, Eq
Species: Hu
Applications: WB (-), ICC/IF, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for KIF2B Antibody (NBP1-70590) (0)

There are no publications for KIF2B Antibody (NBP1-70590).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIF2B Antibody (NBP1-70590) (0)

There are no reviews for KIF2B Antibody (NBP1-70590). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KIF2B Antibody (NBP1-70590) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional KIF2B Products

Bioinformatics Tool for KIF2B Antibody (NBP1-70590)

Discover related pathways, diseases and genes to KIF2B Antibody (NBP1-70590). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIF2B Antibody (NBP1-70590)

Discover more about diseases related to KIF2B Antibody (NBP1-70590).

Pathways for KIF2B Antibody (NBP1-70590)

View related products by pathway.

PTMs for KIF2B Antibody (NBP1-70590)

Learn more about PTMs related to KIF2B Antibody (NBP1-70590).

Blogs on KIF2B

There are no specific blogs for KIF2B, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KIF2B Antibody and receive a gift card or discount.


Gene Symbol KIF2B