KIF1A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: KIF1A Antibody [NBP1-88911] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: KIF1A Antibody [NBP1-88911] - Staining of human cerebral cortex shows cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: KIF1A Antibody [NBP1-88911] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIF1A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SGTAKISFDDQHFEKFQSESCPVVGMSRSGTSQEELRIVEGQGQGADVGPSADEVNNNTCSAVPPEGLLLDSSEKAALDGPLDAALDHLRLGNTFTFRVTVLQASSISAEYADIF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIF1A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KIF1A Protein (NBP1-88911PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KIF1A Antibody

  • heavy chain, member 1A, homolog of mouse
  • kinesin family member 1A
  • unc-104- and KIF1A-related protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4496
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-57493
Species: Hu, Mu
Applications: WB, IP
NBP1-46837
Species: Hu, Mu
Applications: WB, IP
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NB500-180
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, ICC/IF, IP
NBP1-85978
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-59263
Species: Hu
Applications: WB, IHC
NBP2-24769
Species: Hu, Mu, Rt, Po, Ca, Eq, Pm
Applications: WB
NBP1-89273
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85344
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1059
Species: Hu, Ca
Applications: WB, IHC, IHC-P, PEP-ELISA
AF844
Species: Mu
Applications: WB, Block
NBP1-76331
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-59312
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-37957
Species: Hu
Applications: IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84680
Species: Hu
Applications: WB, IHC, IHC-P
H00010908-M08
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-88911
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for KIF1A Antibody (NBP1-88911) (0)

There are no publications for KIF1A Antibody (NBP1-88911).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIF1A Antibody (NBP1-88911) (0)

There are no reviews for KIF1A Antibody (NBP1-88911). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KIF1A Antibody (NBP1-88911) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KIF1A Products

KIF1A NBP1-88911

Bioinformatics Tool for KIF1A Antibody (NBP1-88911)

Discover related pathways, diseases and genes to KIF1A Antibody (NBP1-88911). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIF1A Antibody (NBP1-88911)

Discover more about diseases related to KIF1A Antibody (NBP1-88911).
 

Pathways for KIF1A Antibody (NBP1-88911)

View related products by pathway.

PTMs for KIF1A Antibody (NBP1-88911)

Learn more about PTMs related to KIF1A Antibody (NBP1-88911).

Blogs on KIF1A

There are no specific blogs for KIF1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIF1A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF1A