KIAA2022 Antibody

Images

 
Immunohistochemistry-Paraffin: KIAA2022 Antibody [NBP2-14156] - Staining of human cerebral cortex shows strong cytoplasmic positivity in endothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIAA2022 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FLPTTCSSEMPLSSANVTTNIPVIPGGYLQTLLDASDLSNNTSISYFSHH SPEQNEGSLTQTEKSFVPLQPTQDCVLTSSSDSELQQSSHNFKMESSNYR NVWPNKATSGTQEFMAEVSRE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIAA2022
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KIAA2022 Protein (NBP2-14156PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KIAA2022 Antibody

  • hypothetical protein LOC340533
  • KIAA2022

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91823
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00027130-P02
Species: Hu
H00000518-R01
Species: Hu
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-87375
Species: Hu
Applications: IHC, IHC-P
NBP1-87691
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33463
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14156
Species: Hu
Applications: IHC, IHC-P

Publications for KIAA2022 Antibody (NBP2-14156) (0)

There are no publications for KIAA2022 Antibody (NBP2-14156).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIAA2022 Antibody (NBP2-14156) (0)

There are no reviews for KIAA2022 Antibody (NBP2-14156). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KIAA2022 Antibody (NBP2-14156) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KIAA2022 Products

KIAA2022 NBP2-14156

Bioinformatics Tool for KIAA2022 Antibody (NBP2-14156)

Discover related pathways, diseases and genes to KIAA2022 Antibody (NBP2-14156). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIAA2022 Antibody (NBP2-14156)

Discover more about diseases related to KIAA2022 Antibody (NBP2-14156).
 

Pathways for KIAA2022 Antibody (NBP2-14156)

View related products by pathway.

Blogs on KIAA2022

There are no specific blogs for KIAA2022, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIAA2022 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIAA2022