KIAA1430 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: KIAA1430 Antibody [NBP2-30874] - Staining of human cell line A-431 shows positivity in nucleoli.
Immunohistochemistry: KIAA1430 Antibody [NBP2-30874] - Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

KIAA1430 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SFELGIANDQKVKIKKQENVSQEIYEDVEDLKNNSKYLKAAKKGKEKHEPDVSSKSSSVLDSSLDHRHKQKVLHDTMDLNHLLKA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIAA1430
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Control Peptide
KIAA1430 Protein (NBP2-30874PEP)

Alternate Names for KIAA1430 Antibody

  • KIAA1430

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KIAA1430 Antibody (NBP2-30874) (0)

There are no publications for KIAA1430 Antibody (NBP2-30874).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIAA1430 Antibody (NBP2-30874) (0)

There are no reviews for KIAA1430 Antibody (NBP2-30874). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KIAA1430 Antibody (NBP2-30874) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KIAA1430 Antibody Products

Bioinformatics Tool for KIAA1430 Antibody (NBP2-30874)

Discover related pathways, diseases and genes to KIAA1430 Antibody (NBP2-30874). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on KIAA1430

There are no specific blogs for KIAA1430, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol KIAA1430
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP2-30874 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought