KIAA1430 Antibody (NBP2-30874)


Immunocytochemistry/ Immunofluorescence: KIAA1430 Antibody [NBP2-30874] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli fibrillar center.
Immunohistochemistry: KIAA1430 Antibody [NBP2-30874] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

KIAA1430 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: SFELGIANDQKVKIKKQENVSQEIYEDVEDLKNNSKYLKAAKKGKEKHEPDVSSKSSSVLDSSLDHRHKQKVLHDTMDLNHLLKA
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
Control Peptide
KIAA1430 Protein (NBP2-30874PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for KIAA1430 Antibody

  • KIAA1430


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KIAA1430 Antibody (NBP2-30874) (0)

There are no publications for KIAA1430 Antibody (NBP2-30874).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIAA1430 Antibody (NBP2-30874) (0)

There are no reviews for KIAA1430 Antibody (NBP2-30874). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KIAA1430 Antibody (NBP2-30874) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional KIAA1430 Products

Bioinformatics Tool for KIAA1430 Antibody (NBP2-30874)

Discover related pathways, diseases and genes to KIAA1430 Antibody (NBP2-30874). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on KIAA1430

There are no specific blogs for KIAA1430, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KIAA1430 Antibody and receive a gift card or discount.


Gene Symbol KIAA1430