Recombinant Human KIAA1199 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human KIAA1199 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 880-979 of Human KIAA1199 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LYDGPINIQNCTFRKFVALEGRHTSALAFRLNNAWQSCPHNNVTGIAFEDVPITSRVFFGEPGPWFNQLDMDGDKTSVFHDVDGSVSEYPGSYLTKNDNW

Protein/Peptide Type
Partial Recombinant Protein
Gene
KIAA1199

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human KIAA1199 Protein

  • CCSP1
  • colon cancer secreted protein 1
  • IR2155535
  • KIAA1199
  • TMEM2L

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85161
Species: Hu
Applications: IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33084
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57648
Species: Hu
Applications: WB, ICC/IF
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-02829
Species: Hu, Rt, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29421
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-91561
Species: Hu
Applications: WB
H00010518-A01
Species: Hu, Ze
Applications: WB, ELISA
NBP1-59576
Species: Hu
Applications: WB, IHC
NBP2-58195
Species: Hu
Applications: ICC/IF
MAB5275
Species: Hu
Applications: Flow, CyTOF-ready, ICFlow
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80865
Species: Hu
Applications: IHC, IHC-P
H00000825-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-52030
Species: Hu
Applications: WB, PEP-ELISA
NBP2-24464
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC-P
H00057214-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for KIAA1199 Partial Recombinant Protein (H00057214-Q01) (0)

There are no publications for KIAA1199 Partial Recombinant Protein (H00057214-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIAA1199 Partial Recombinant Protein (H00057214-Q01) (0)

There are no reviews for KIAA1199 Partial Recombinant Protein (H00057214-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KIAA1199 Partial Recombinant Protein (H00057214-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KIAA1199 Products

Bioinformatics Tool for KIAA1199 Partial Recombinant Protein (H00057214-Q01)

Discover related pathways, diseases and genes to KIAA1199 Partial Recombinant Protein (H00057214-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIAA1199 Partial Recombinant Protein (H00057214-Q01)

Discover more about diseases related to KIAA1199 Partial Recombinant Protein (H00057214-Q01).
 

Pathways for KIAA1199 Partial Recombinant Protein (H00057214-Q01)

View related products by pathway.

PTMs for KIAA1199 Partial Recombinant Protein (H00057214-Q01)

Learn more about PTMs related to KIAA1199 Partial Recombinant Protein (H00057214-Q01).

Blogs on KIAA1199

There are no specific blogs for KIAA1199, but you can read our latest blog posts.

Customers Who Bought This Also Bought

KIAA1199 Antibody
45750002-0.1mg

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human KIAA1199 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KIAA1199