Recombinant Human KIAA1199 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human KIAA1199 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 880-979 of Human KIAA1199

Source: Wheat Germ

Amino Acid Sequence: LYDGPINIQNCTFRKFVALEGRHTSALAFRLNNAWQSCPHNNVTGIAFEDVPITSRVFFGEPGPWFNQLDMDGDKTSVFHDVDGSVSEYPGSYLTKNDNW

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
KIAA1199
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human KIAA1199 Protein

  • CCSP1
  • colon cancer secreted protein 1
  • IR2155535
  • KIAA1199
  • TMEM2L

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85161
Species: Hu
Applications: IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33084
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57648
Species: Hu
Applications: WB, ICC/IF
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-02829
Species: Hu, Rt, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29421
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-94168
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010518-A01
Species: Hu, Ze
Applications: WB, ChIP, ELISA
NBP1-59576
Species: Hu, Mu
Applications: WB, IHC
NBP2-58490
Species: Hu
Applications: ICC/IF
MAB5275
Species: Hu
Applications: Flow, CyTOF-ready, ICFlow
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80865
Species: Hu
Applications: IHC, IHC-P
NBP2-34061
Species: Hu
Applications: IHC, IHC-P
NBP1-52030
Species: Hu
Applications: WB, PEP-ELISA
NBP2-24464
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC-P

Publications for KIAA1199 Partial Recombinant Protein (H00057214-Q01) (0)

There are no publications for KIAA1199 Partial Recombinant Protein (H00057214-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIAA1199 Partial Recombinant Protein (H00057214-Q01) (0)

There are no reviews for KIAA1199 Partial Recombinant Protein (H00057214-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KIAA1199 Partial Recombinant Protein (H00057214-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KIAA1199 Products

Bioinformatics Tool for KIAA1199 Partial Recombinant Protein (H00057214-Q01)

Discover related pathways, diseases and genes to KIAA1199 Partial Recombinant Protein (H00057214-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIAA1199 Partial Recombinant Protein (H00057214-Q01)

Discover more about diseases related to KIAA1199 Partial Recombinant Protein (H00057214-Q01).
 

Pathways for KIAA1199 Partial Recombinant Protein (H00057214-Q01)

View related products by pathway.

PTMs for KIAA1199 Partial Recombinant Protein (H00057214-Q01)

Learn more about PTMs related to KIAA1199 Partial Recombinant Protein (H00057214-Q01).

Blogs on KIAA1199

There are no specific blogs for KIAA1199, but you can read our latest blog posts.

Customers Who Bought This Also Bought

KIAA1199 Antibody
45750002-0.1mg
IL-11
418-ML-005

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human KIAA1199 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KIAA1199