KIAA1199 Antibody

Images

 
Western Blot: KIAA1199 Antibody [NBP1-58029] - Sample Tissue: Human OVCAR-3 Antibody Dilution: 1.0 ug/ml
Western Blot: KIAA1199 Antibody [NBP1-58029] - COLO205 cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIAA1199 Antibody Summary

Immunogen
Synthetic peptides corresponding to KIAA1199(KIAA1199) The peptide sequence was selected from the middle region of KIAA1199. Peptide sequence PFLSIISARYSPHQDADPLKPREPAIIRHFIAYKNQDHGAWLRGGDVWLD.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIAA1199
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against KIAA1199 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KIAA1199 Antibody

  • CCSP1
  • colon cancer secreted protein 1
  • IR2155535
  • KIAA1199
  • TMEM2L

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85161
Species: Hu
Applications: IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33084
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57648
Species: Hu
Applications: WB, ICC/IF
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-02829
Species: Hu, Rt, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29421
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-91561
Species: Hu
Applications: WB
H00010518-A01
Species: Hu, Ze
Applications: WB, ELISA
NBP1-59576
Species: Hu
Applications: WB, IHC
NBP2-58195
Species: Hu
Applications: ICC/IF
MAB5275
Species: Hu
Applications: Flow, CyTOF-ready, ICFlow
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80865
Species: Hu
Applications: IHC, IHC-P
H00000825-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-52030
Species: Hu
Applications: WB, PEP-ELISA
NBP2-24464
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC-P
NBP1-58029
Species: Hu
Applications: WB

Publications for KIAA1199 Antibody (NBP1-58029) (0)

There are no publications for KIAA1199 Antibody (NBP1-58029).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIAA1199 Antibody (NBP1-58029) (0)

There are no reviews for KIAA1199 Antibody (NBP1-58029). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KIAA1199 Antibody (NBP1-58029) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KIAA1199 Products

Bioinformatics Tool for KIAA1199 Antibody (NBP1-58029)

Discover related pathways, diseases and genes to KIAA1199 Antibody (NBP1-58029). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIAA1199 Antibody (NBP1-58029)

Discover more about diseases related to KIAA1199 Antibody (NBP1-58029).
 

Pathways for KIAA1199 Antibody (NBP1-58029)

View related products by pathway.

PTMs for KIAA1199 Antibody (NBP1-58029)

Learn more about PTMs related to KIAA1199 Antibody (NBP1-58029).

Blogs on KIAA1199

There are no specific blogs for KIAA1199, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIAA1199 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIAA1199
Uniprot