KIAA1161 Antibody

Images

 
Immunohistochemistry-Paraffin: KIAA1161 Antibody [NBP2-31830] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIAA1161 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GEVTDTGDPIVRPLWWIAPGDETAHRIDSQFLIGDTLLVAPVLEPGKQERDVYLPAGKWRSYKGELFDKTPVLLTDYPVDLDEI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIAA1161
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KIAA1161 Protein (NBP2-31830PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KIAA1161 Antibody

  • EC 3.2.1.-
  • hypothetical protein LOC57462
  • KIAA1161
  • NET37

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for KIAA1161 Antibody (NBP2-31830) (0)

There are no publications for KIAA1161 Antibody (NBP2-31830).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIAA1161 Antibody (NBP2-31830) (0)

There are no reviews for KIAA1161 Antibody (NBP2-31830). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KIAA1161 Antibody (NBP2-31830). (Showing 1 - 1 of 1 FAQ).

  1. Can you let me know the approximate concentration of NBP2-31830?
    • The current production of our KIAA1161 antibody, which has lot number R85105, is at 0.05mg/ml.

Secondary Antibodies

 

Isotype Controls

Additional KIAA1161 Products

Bioinformatics Tool for KIAA1161 Antibody (NBP2-31830)

Discover related pathways, diseases and genes to KIAA1161 Antibody (NBP2-31830). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for KIAA1161 Antibody (NBP2-31830)

Find related products by research area.

Blogs on KIAA1161

There are no specific blogs for KIAA1161, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIAA1161 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIAA1161
Uniprot