KIAA0247 Antibody

Images

 
Western Blot: KIAA0247 Antibody [NBP1-69581] - This Anti-KIAA0247 antibody was used in Western Blot of Fetal Liver tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIAA0247 Antibody Summary

Immunogen
Synthetic peptides corresponding to KIAA0247(KIAA0247) The peptide sequence was selected from the N terminal of KIAA0247. Peptide sequence YLCAEGYMLKGDYKYLTCKNGEWKPAMEISCRLNEDKDTHTSLGVPTLSI.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIAA0247
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against KIAA0247 and was validated on Western blot.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KIAA0247 Antibody

  • hypothetical protein LOC9766
  • KIAA0247

Background

KIAA0247 is a single-pass type I membrane protein. It contains 1 Sushi (CCP/SCR) domain. The function of the KIAA0247 protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-32530
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-42795
Species: Hu
Applications: WB, Flow, Func, IHC, IHC-Fr, IP, CyTOF-ready
NBP1-90791
Species: Hu
Applications: IHC, IHC-P
AF7177
Species: Hu
Applications: WB, ICC
NBP1-84420
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NBP1-31330
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-86999
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89657
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-30707
Species: Hu
Applications: ICC/IF, IHC, IHC-P
796-IC
Species: Mu
NBP1-69581
Species: Hu
Applications: WB

Publications for KIAA0247 Antibody (NBP1-69581) (0)

There are no publications for KIAA0247 Antibody (NBP1-69581).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIAA0247 Antibody (NBP1-69581) (0)

There are no reviews for KIAA0247 Antibody (NBP1-69581). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KIAA0247 Antibody (NBP1-69581) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KIAA0247 Products

Bioinformatics Tool for KIAA0247 Antibody (NBP1-69581)

Discover related pathways, diseases and genes to KIAA0247 Antibody (NBP1-69581). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIAA0247 Antibody (NBP1-69581)

Discover more about diseases related to KIAA0247 Antibody (NBP1-69581).
 

Pathways for KIAA0247 Antibody (NBP1-69581)

View related products by pathway.

Blogs on KIAA0247

There are no specific blogs for KIAA0247, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIAA0247 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIAA0247
Uniprot