KIAA0020 Antibody

Images

 
Western Blot: KIAA0020 Antibody [NBP1-87296] - Analysis in human cell line HDLM-2.
Immunocytochemistry/ Immunofluorescence: KIAA0020 Antibody [NBP1-87296] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli.
Immunohistochemistry-Paraffin: KIAA0020 Antibody [NBP1-87296] - Staining of human breast shows nuclear membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIAA0020 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EHAQEVVLDKSACVLVSDILGSATGDVQPTMNAIASLAATGLHPGGKDGELHIAEHPAGHLVLKWLIEQDKKMKENGREGCFAKTLVEHVGMKNLKSWASVNRGAIILSSLLQSCDLEVANKVKAALKSLIPTLEKTKSTSKGI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIAA0020
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KIAA0020 Protein (NBP1-87296PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KIAA0020 Antibody

  • HBV X-transactivated gene 5 protein
  • HLA-HA8MGC8749
  • KIAA0020 protein
  • KIAA0020
  • Minor histocompatibility antigen HA-8
  • PEN
  • penguin homolog
  • protein 5 transactivated by hepatitis B virus X antigen (HBxAg)
  • PUF6
  • XTP5HBV XAg-transactivated protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB6967
Species: Hu
Applications: WB
NB110-37256
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12553
Species: Hu
H00347527-B01P
Species: Hu
Applications: WB, ELISA
MAB38461
Species: Hu
Applications: WB, IHC
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF4409
Species: Mu
Applications: WB
NB200-335
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP2-19819
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-42664
Species: Hu
Applications: WB, IHC, IP
H00001831-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-87296
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for KIAA0020 Antibody (NBP1-87296) (0)

There are no publications for KIAA0020 Antibody (NBP1-87296).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIAA0020 Antibody (NBP1-87296) (0)

There are no reviews for KIAA0020 Antibody (NBP1-87296). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KIAA0020 Antibody (NBP1-87296) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KIAA0020 Products

Bioinformatics Tool for KIAA0020 Antibody (NBP1-87296)

Discover related pathways, diseases and genes to KIAA0020 Antibody (NBP1-87296). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIAA0020 Antibody (NBP1-87296)

Discover more about diseases related to KIAA0020 Antibody (NBP1-87296).
 

Pathways for KIAA0020 Antibody (NBP1-87296)

View related products by pathway.

PTMs for KIAA0020 Antibody (NBP1-87296)

Learn more about PTMs related to KIAA0020 Antibody (NBP1-87296).

Blogs on KIAA0020

There are no specific blogs for KIAA0020, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIAA0020 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIAA0020