KIAA0020 Antibody


Western Blot: KIAA0020 Antibody [NBP1-57531] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml
Immunohistochemistry: KIAA0020 Antibody [NBP1-57531] - Human alveolar cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.
Immunohistochemistry-Paraffin: KIAA0020 Antibody [NBP1-57531] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

KIAA0020 Antibody Summary

Synthetic peptides corresponding to KIAA0020 (KIAA0020) The peptide sequence was selected from the N terminal of KIAA0020. Peptide sequence GKKGVKQFKNKQQGDKSPKNKFQPANKFNKKRKFQPDGRSDESAAKKPKW.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against KIAA0020 and was validated on Western Blot and immunohistochemistry-paraffin
Positive Control
KIAA0020 Lysate (NBP2-65110)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KIAA0020 Antibody

  • HBV X-transactivated gene 5 protein
  • HLA-HA8MGC8749
  • KIAA0020 protein
  • KIAA0020
  • Minor histocompatibility antigen HA-8
  • PEN
  • penguin homolog
  • protein 5 transactivated by hepatitis B virus X antigen (HBxAg)
  • PUF6
  • XTP5HBV XAg-transactivated protein 5


KIAA0020 contains 6 pumilio repeats and 1PUM-HD domain. The function remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IP
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P

Publications for KIAA0020 Antibody (NBP1-57531) (0)

There are no publications for KIAA0020 Antibody (NBP1-57531).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIAA0020 Antibody (NBP1-57531) (0)

There are no reviews for KIAA0020 Antibody (NBP1-57531). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KIAA0020 Antibody (NBP1-57531) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional KIAA0020 Products

Bioinformatics Tool for KIAA0020 Antibody (NBP1-57531)

Discover related pathways, diseases and genes to KIAA0020 Antibody (NBP1-57531). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIAA0020 Antibody (NBP1-57531)

Discover more about diseases related to KIAA0020 Antibody (NBP1-57531).

Pathways for KIAA0020 Antibody (NBP1-57531)

View related products by pathway.

PTMs for KIAA0020 Antibody (NBP1-57531)

Learn more about PTMs related to KIAA0020 Antibody (NBP1-57531).

Blogs on KIAA0020

There are no specific blogs for KIAA0020, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KIAA0020 Antibody and receive a gift card or discount.


Gene Symbol KIAA0020