KIAA0020 Antibody

Images

 
Western Blot: KIAA0020 Antibody [NBP1-57531] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml
Immunohistochemistry: KIAA0020 Antibody [NBP1-57531] - Human alveolar cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.
Immunohistochemistry-Paraffin: KIAA0020 Antibody [NBP1-57531] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIAA0020 Antibody Summary

Immunogen
Synthetic peptides corresponding to KIAA0020 (KIAA0020) The peptide sequence was selected from the N terminal of KIAA0020. Peptide sequence GKKGVKQFKNKQQGDKSPKNKFQPANKFNKKRKFQPDGRSDESAAKKPKW.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIAA0020
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against KIAA0020 and was validated on Western Blot and immunohistochemistry-paraffin

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KIAA0020 Antibody

  • HBV X-transactivated gene 5 protein
  • HLA-HA8MGC8749
  • KIAA0020 protein
  • KIAA0020
  • Minor histocompatibility antigen HA-8
  • PEN
  • penguin homolog
  • protein 5 transactivated by hepatitis B virus X antigen (HBxAg)
  • PUF6
  • XTP5HBV XAg-transactivated protein 5

Background

KIAA0020 contains 6 pumilio repeats and 1PUM-HD domain. The function remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB6967
Species: Hu
Applications: WB
NB110-37256
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12553
Species: Hu
H00347527-B01P
Species: Hu
Applications: WB, ELISA
MAB38461
Species: Hu
Applications: WB, IHC
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF4409
Species: Mu
Applications: WB
NB200-335
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP2-19819
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-42664
Species: Hu
Applications: WB, IHC, IP
H00001831-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-57531
Species: Hu
Applications: WB, IHC, IHC-P

Publications for KIAA0020 Antibody (NBP1-57531) (0)

There are no publications for KIAA0020 Antibody (NBP1-57531).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIAA0020 Antibody (NBP1-57531) (0)

There are no reviews for KIAA0020 Antibody (NBP1-57531). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KIAA0020 Antibody (NBP1-57531) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KIAA0020 Products

Bioinformatics Tool for KIAA0020 Antibody (NBP1-57531)

Discover related pathways, diseases and genes to KIAA0020 Antibody (NBP1-57531). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIAA0020 Antibody (NBP1-57531)

Discover more about diseases related to KIAA0020 Antibody (NBP1-57531).
 

Pathways for KIAA0020 Antibody (NBP1-57531)

View related products by pathway.

PTMs for KIAA0020 Antibody (NBP1-57531)

Learn more about PTMs related to KIAA0020 Antibody (NBP1-57531).

Blogs on KIAA0020

There are no specific blogs for KIAA0020, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIAA0020 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIAA0020
Uniprot