Keratin 36 Antibody

Images

 
Western Blot: Keratin 36 Antibody [NBP1-74089] - Lane: Fetal Kidney Lysate, Antibody Titration :1 ug/ml, and Gel concentration :12%

Product Details

Summary
Product Discontinued
View other related Keratin 36 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-74089
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Keratin 36 Antibody Summary

Immunogen
Synthetic peptides corresponding to the N terminal of KRT36. Immunizing peptide sequence IEDFQQKILLTKSENARLVLQIDNAKLAADDFRTKYETELSLRQLVEADI.
Clonality
Polyclonal
Host
Rabbit
Gene
KRT36
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against KRT36 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Keratin 36 Antibody

  • HA6
  • Hair keratin, type I Ha6
  • hHa6
  • HKA6
  • K36
  • keratin 36
  • keratin, hair, acidic, 6
  • keratin-36
  • KRTHA6keratin, type I cuticular Ha6

Background

The protein encoded by this gene is a member of the keratin gene family. This type I hair keratin is an acidic protein which heterodimerizes with type II keratins to form hair and nails. The type I hair keratins are clustered in a region of chromosome 17q12-q21 and have the same direction of transcription.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
H00003882-B01P
Species: Hu
Applications: WB
NBP2-58830
Species: Hu
Applications: ICC/IF, IHC-P
H00003886-D01P
Species: Hu
Applications: WB
NBP2-19310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77033
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-93290
Species: Hu, Mu
Applications: WB, IHC-P, IP
AF2567
Species: Mu
Applications: WB, IHC
NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00003851-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-14954
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-74602
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-52030
Species: Hu
Applications: WB, PEP-ELISA
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-74089
Species: Hu
Applications: WB

Publications for Keratin 36 Antibody (NBP1-74089) (0)

There are no publications for Keratin 36 Antibody (NBP1-74089).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Keratin 36 Antibody (NBP1-74089) (0)

There are no reviews for Keratin 36 Antibody (NBP1-74089). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Keratin 36 Antibody (NBP1-74089) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Keratin 36 Products

Bioinformatics Tool for Keratin 36 Antibody (NBP1-74089)

Discover related pathways, diseases and genes to Keratin 36 Antibody (NBP1-74089). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Keratin 36

There are no specific blogs for Keratin 36, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Keratin 36 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KRT36
Uniprot