KDELR3 Antibody

Images

 
Western Blot: KDELR3 Antibody [NBP1-69653] - This Anti-KDELR3 antibody was used in Western Blot of Fetal Heart tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Product Discontinued
View other related KDELR3 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69653
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

KDELR3 Antibody Summary

Immunogen
Synthetic peptides corresponding to KDELR3(KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 3) The peptide sequence was selected from the middle region of KDELR3. Peptide sequence AYVTVYMIYGKFRKTFDSENDTFRLEFLLVPVIGLS
Clonality
Polyclonal
Host
Rabbit
Gene
KDELR3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against KDELR3 and was validated on Western blot.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KDELR3 Antibody

  • ER lumen protein retaining receptor 3
  • ERD2L3
  • KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 3
  • KDEL endoplasmic reticulum protein retention receptor 3
  • KDEL receptor 3

Background

Retention of resident soluble proteins in the lumen of the endoplasmic reticulum (ER) is achieved in both yeast and animal cells by their continual retrieval from the cis-Golgi, or a pre-Golgi compartment. Sorting of these proteins is dependent on a C-terminal tetrapeptide signal, usually lys-asp-glu-leu (KDEL) in animal cells, and his-asp-glu-leu (HDEL) in S. cerevisiae. This process is mediated by a receptor that recognizes, and binds the tetrapeptide-containing protein, and returns it to the ER. In yeast, the sorting receptor encoded by a single gene, ERD2, is a seven-transmembrane protein. Unlike yeast, several human homologs of the ERD2 gene, constituting the KDEL receptor gene family, have been described. KDELR3 was the third member of the family to be identified, and it encodes a protein highly homologous to KDELR1 and KDELR2 proteins.Retention of resident soluble proteins in the lumen of the endoplasmic reticulum (ER) is achieved in both yeast and animal cells by their continual retrieval from the cis-Golgi, or a pre-Golgi compartment. Sorting of these proteins is dependent on a C-terminal tetrapeptide signal, usually lys-asp-glu-leu (KDEL) in animal cells, and his-asp-glu-leu (HDEL) in S. cerevisiae. This process is mediated by a receptor that recognizes, and binds the tetrapeptide-containing protein, and returns it to the ER. In yeast, the sorting receptor encoded by a single gene, ERD2, is a seven-transmembrane protein. Unlike yeast, several human homologs of the ERD2 gene, constituting the KDEL receptor gene family, have been described. KDELR3 was the third member of the family to be identified, and it encodes a protein highly homologous to KDELR1 and KDELR2 proteins. Two transcript variants of KDELR3 that arise by alternative splicing, and encode different isoforms of KDELR3 receptor, have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1015
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-40256
Species: Hu, Mu, Rt, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP2-27398
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-83083
Species: Hu
Applications: IHC, IHC-P

Publications for KDELR3 Antibody (NBP1-69653) (0)

There are no publications for KDELR3 Antibody (NBP1-69653).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KDELR3 Antibody (NBP1-69653) (0)

There are no reviews for KDELR3 Antibody (NBP1-69653). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KDELR3 Antibody (NBP1-69653) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KDELR3 Products

Bioinformatics Tool for KDELR3 Antibody (NBP1-69653)

Discover related pathways, diseases and genes to KDELR3 Antibody (NBP1-69653). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KDELR3 Antibody (NBP1-69653)

Discover more about diseases related to KDELR3 Antibody (NBP1-69653).
 

Pathways for KDELR3 Antibody (NBP1-69653)

View related products by pathway.

PTMs for KDELR3 Antibody (NBP1-69653)

Learn more about PTMs related to KDELR3 Antibody (NBP1-69653).

Blogs on KDELR3

There are no specific blogs for KDELR3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KDELR3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KDELR3
Uniprot