KCNT1 Antibody

Images

 
Western Blot: KCNT1 Antibody [NBP1-74153] - Mouse Heart Lysate 1.0 ug/ml, gel concentration 6-18%

Product Details

Summary
Product Discontinued
View other related KCNT1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-74153
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

KCNT1 Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of Kcnt1. Immunizing peptide sequence CDLLSDQSEDEVTPSDDEGLSVVEYVKGYPPNSPYIGSSPTLCHLLPVKA.
Clonality
Polyclonal
Host
Rabbit
Gene
KCNT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Kcnt1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KCNT1 Antibody

  • bA100C15.2
  • KCa4.1KIAA1422FLJ41282
  • potassium channel subfamily T member 1
  • potassium channel, subfamily T, member 1
  • SLACK

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-47606
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-37429
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-40840
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-82859
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56490
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
AF6517
Species: Hu
Applications: WB
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP2-04611
Species: Hu
AF5745
Species: Hu
Applications: WB, IHC
NBP1-59934
Species: Hu
Applications: WB
AF6387
Species: Hu
Applications: WB
NBP1-74153
Species: Mu
Applications: WB

Publications for KCNT1 Antibody (NBP1-74153) (0)

There are no publications for KCNT1 Antibody (NBP1-74153).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCNT1 Antibody (NBP1-74153) (0)

There are no reviews for KCNT1 Antibody (NBP1-74153). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KCNT1 Antibody (NBP1-74153) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KCNT1 Products

Bioinformatics Tool for KCNT1 Antibody (NBP1-74153)

Discover related pathways, diseases and genes to KCNT1 Antibody (NBP1-74153). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCNT1 Antibody (NBP1-74153)

Discover more about diseases related to KCNT1 Antibody (NBP1-74153).
 

Pathways for KCNT1 Antibody (NBP1-74153)

View related products by pathway.

PTMs for KCNT1 Antibody (NBP1-74153)

Learn more about PTMs related to KCNT1 Antibody (NBP1-74153).

Blogs on KCNT1

There are no specific blogs for KCNT1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KCNT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNT1
Uniprot