KCNRG Antibody

Images

 
Western Blot: KCNRG Antibody [NBP1-80209] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related KCNRG Primary Antibodies

Order Details


    • Catalog Number
      NBP1-80209
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

KCNRG Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human KCNRG. Peptide sequence MSSQELVTLNVGGKIFTTRFSTIKQFPASRLARMLDGRDQEFKMVGGQIF.
Clonality
Polyclonal
Host
Rabbit
Gene
KCNRG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against KCNRG and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KCNRG Antibody

  • CLLD4
  • potassium channel regulatorDLTET
  • Protein CLLD4
  • putative potassium channel regulatory protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-48725
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85016
Species: Hu
Applications: WB, IHC, IHC-P
AF3758
Species: Hu, Mu
Applications: WB, Simple Western, ICC, KO
NBP2-12897
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
NLS836
Species: Hu, Mk, Pm
Applications: IHC-P
NB100-1063
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-82874
Species: Hu
Applications: IHC, IHC-P
H00003753-M01
Species: Hu
Applications: WB, ELISA, RNAi
26660002
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP2-75552
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
NBP2-24470
Species: Hu
Applications: WB, Simple Western, IHC-P
AF7318
Species: Hu
Applications: IHC
H00006444-M01-100ug
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
H00004760-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80209
Species: Hu
Applications: WB

Publications for KCNRG Antibody (NBP1-80209) (0)

There are no publications for KCNRG Antibody (NBP1-80209).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCNRG Antibody (NBP1-80209) (0)

There are no reviews for KCNRG Antibody (NBP1-80209). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KCNRG Antibody (NBP1-80209) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for KCNRG Antibody (NBP1-80209)

Discover related pathways, diseases and genes to KCNRG Antibody (NBP1-80209). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCNRG Antibody (NBP1-80209)

Discover more about diseases related to KCNRG Antibody (NBP1-80209).
 

Pathways for KCNRG Antibody (NBP1-80209)

View related products by pathway.

Blogs on KCNRG

There are no specific blogs for KCNRG, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KCNRG Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNRG
Uniprot