KCNN2 Antibody

Images

 
Immunohistochemistry-Paraffin: KCNN2 Antibody [NBP1-83187] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KCNN2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALPGLISQTIRQQQRDFIEAQMESYDKHVTYNAERS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KCNN2 Protein (NBP1-83187PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KCNN2 Antibody

  • hSK2
  • KCa2.2SKCA2
  • potassium intermediate/small conductance calcium-activated channel, subfamilyN, member 2
  • SK2apamin-sensitive small-conductance Ca2+-activated potassium channel
  • SKCa 2
  • SKCa2
  • small conductance calcium-activated potassium channel protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57340
Species: Hu
Applications: ICC/IF
NBP2-55459
Species: Hu
Applications: ICC/IF
NBP1-33470
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33694
Species: Hu
Applications: IHC, IHC-P
NBP1-98474
Species: Hu
Applications: WB
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP2-20119
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00008720-M07
Species: Hu
Applications: ELISA, ICC/IF
NB120-10535
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, MiAr
AF2180
Species: Hu
Applications: WB, Simple Western, IP
H00003738-M01
Species: Hu
Applications: WB, ELISA
H00008877-M01
Species: Hu
Applications: WB, ELISA
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-83187
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for KCNN2 Antibody (NBP1-83187) (0)

There are no publications for KCNN2 Antibody (NBP1-83187).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCNN2 Antibody (NBP1-83187) (0)

There are no reviews for KCNN2 Antibody (NBP1-83187). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KCNN2 Antibody (NBP1-83187) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KCNN2 Products

Bioinformatics Tool for KCNN2 Antibody (NBP1-83187)

Discover related pathways, diseases and genes to KCNN2 Antibody (NBP1-83187). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCNN2 Antibody (NBP1-83187)

Discover more about diseases related to KCNN2 Antibody (NBP1-83187).
 

Pathways for KCNN2 Antibody (NBP1-83187)

View related products by pathway.

PTMs for KCNN2 Antibody (NBP1-83187)

Learn more about PTMs related to KCNN2 Antibody (NBP1-83187).

Blogs on KCNN2

There are no specific blogs for KCNN2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KCNN2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNN2