KCNJ10 Antibody (1C11) - Azide and BSA Free

Immunohistochemistry: KCNJ10 Antibody (1C11) [H00003766-M01] - Cx43, Cx30, and KCNJ10 (Kir4.1) (H00003766-M01) immunoreactivity. Immunoreactivity for Cx43 was maximal at P12 and decayed with age, whereas Cx30 levels increased at later developmental stages. Kir4.1 exhibited a moderately elevated level during the second postnatal week. The last row depicts negative controls at P20, in which the primary antibodies for Cx43 and Cx30 were omitted.Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30542265/) licensed under a CC-BY license.

Sandwich ELISA: KCNJ10 Antibody (1C11) [H00003766-M01] - Detection limit for recombinant GST tagged KCNJ10 is approximately 0.03ng/ml as a capture antibody.

Immunohistochemistry: KCNJ10 Antibody (1C11) [H00003766-M01] - Cx43, Cx30, & Kir4.1 immunoreactivity. (A) Schematic drawing of an auditory brainstem slice containing the central part of the inferior colliculus (ICC; A1). The tonotopic organization is indicated by dotted lines (A2). The dotted box denotes the area in which Cx expression was analyzed. (B) Immunoreactivity for Cx43 was maximal at P12 & decayed with age, whereas Cx30 levels increased at later developmental stages. Kir4.1 exhibited a moderately elevated level during the second postnatal week. The last row depicts negative controls at P20, in which the primary antibodies for Cx43 & Cx30 were omitted. (C) Developmental profile of Cx43 (C1), Cx30 (C2), & Kir4.1 expression (C3). The dotted gray lines in (C1,2) denote developmental background fluorescence signals at P7–30 obtained after omitting primary antibodies. n represents the number of analyzed slices & is provided within the diagrams; shown are mean values ± SEM. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30542265), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC, IP
• Clone: 1C11
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

KCNJ10 Antibody (1C11) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: KCNJ10 (NP_002232, 276 a.a. ~ 379 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV
• Specificity: KCNJ10 - potassium inwardly-rectifying channel, subfamily J, member 10
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: KCNJ10
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunoprecipitation
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against recombinant protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. IHC usage reported in scientific literature (PMID: 27458984).

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30542265). Rat reactivity reported in scientific literature (PMID: 19009624).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KCNJ10 Antibody (1C11) - Azide and BSA Free

• ATP-dependent inwardly rectifying potassium channel Kir4.1
• ATP-sensitive inward rectifier potassium channel 10
• BIRK-10
• glial ATP-dependent inwardly rectifying potassium channel KIR4.1
• Inward rectifier K(+) channel Kir1.2
• inward rectifier K+ channel KIR1.2
• KCNJ10
• KCNJ13-PEN
• KIR1.2
• KIR4.1
• Potassium channel, inwardly rectifying subfamily J member 10
• potassium inwardly-rectifying channel, subfamily J, member 10
• SESAME

Background

This gene encodes a member of the inward rectifier-type potassium channel family, characterized by having a greater tendency to allow potassium to flow into, rather than out of, a cell. The encoded protein may form a heterodimer with another potassium channel protein and may be responsible for the potassium buffering action of glial cells in the brain. Mutations in this gene have been associated with seizure susceptibility of common idiopathic generalized epilepsy syndromes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KCNJ10 Antibody (H00003766-M01)(5)

Publications using H00003766-M01

• Wadle SL, Augustin V, Langer J et al. Anisotropic Panglial Coupling Reflects Tonotopic Organization in the Inferior Colliculus Front Cell Neurosci 2018-11-27 [PMID: 30542265] (IF/IHC, Mouse)
• Augustin V, Bold C, Wadle SL et al. Functional anisotropic panglial networks in the lateral superior olive Glia 2016-07-26 [PMID: 27458984] (IF/IHC, Mouse)
• Moritz CP, Eckstein E, Tenzer S et al. Neuroproteomics in the Auditory Brainstem: Candidate Proteins for Ultrafast and Precise Information Processing Mol. Cell. Neurosci. 2014-08-13 [PMID: 25131618]
• Wang XH, Streeter M, Liu YP et al. Identification and characterization of pannexin expression in the mammalian cochlea. J Comp Neurol;512(3):336-46. 2009-01-20 [PMID: 19009624] (WB, Mouse, Rat)
• Singh R, Wangemann P. Free radical stress-mediated loss of Kcnj10 protein expression in stria vascularis contributes to deafness in Pendred syndrome mouse model. Am J Physiol Renal Physiol;294(1):F139-48. 2008-01-01 [PMID: 17959752] (WB, Mouse)

Bioinformatics

• Gene Symbol: KCNJ10
• Entrez:
  • 3766(Human)
• OMIM:
  • 602208(Human)
• Uniprot:
  • NP_002232(Human)