Katanin p60 Antibody

Images

 
Western Blot: Katanin p60 Antibody [NBP1-74115] - Mouse Spleen Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Product Discontinued
View other related Katanin p60 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-74115
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Katanin p60 Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of Katanin p60. Immunizing peptide sequence DDPSKMVMVLAATNFPWDIDEALRRRLEKRIYIPLPSAKGREELLRISLR.
Specificity
This product is specific to Subunit or Isofrom: A1.
Clonality
Polyclonal
Host
Rabbit
Gene
KATNA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Katna1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Katanin p60 Antibody

  • EC 3.6.4.3
  • katanin p60 (ATPase containing) subunit A 1
  • katanin p60 (ATPase-containing) subunit A 1
  • katanin p60 ATPase-containing subunit A1
  • Katanin p60 subunit A1
  • Katanin p60
  • KATNA1
  • p60 katanin

Background

Katna1 severs microtubules in vitro in an ATP-dependent manner. This activity may promote rapid reorganization of cellular microtubule arrays, such as that seen during disassembly of interphase microtubules at the G2-M transition.It may also be required for microtubule release from the centrosome after nucleation. In mitotic spindles this could allow depolymerization of the microtubule end proximal to the centrosome, and subsequent poleward microtubule flux. In neurons, microtubule release within the cell body allows their subsequent transport into neuronal processes by microtubule dependent motor proteins. This transport is required for axonal growth.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-01383
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-74115
Species: Mu
Applications: WB

Publications for Katanin p60 Antibody (NBP1-74115) (0)

There are no publications for Katanin p60 Antibody (NBP1-74115).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Katanin p60 Antibody (NBP1-74115) (0)

There are no reviews for Katanin p60 Antibody (NBP1-74115). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Katanin p60 Antibody (NBP1-74115) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Katanin p60 Products

Bioinformatics Tool for Katanin p60 Antibody (NBP1-74115)

Discover related pathways, diseases and genes to Katanin p60 Antibody (NBP1-74115). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Katanin p60

There are no specific blogs for Katanin p60, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Katanin p60 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KATNA1
Entrez
Uniprot