Katanin p60 Antibody

Product Details

Product Discontinued
View other related Katanin p60 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Katanin p60 Antibody Summary

Synthetic peptides corresponding to the C terminal of Katanin p60. Immunizing peptide sequence DDPSKMVMVLAATNFPWDIDEALRRRLEKRIYIPLPSAKGREELLRISLR.
This product is specific to Subunit or Isofrom: A1.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified

Application Notes
This is a rabbit polyclonal antibody against Katna1 and was validated on Western blot.

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Katna1 severs microtubules in vitro in an ATP-dependent manner. This activity may promote rapid reorganization of cellular microtubule arrays, such as that seen during disassembly of interphase microtubules at the G2-M transition.It may also be required for microtubule release from the centrosome after nucleation. In mitotic spindles this could allow depolymerization of the microtubule end proximal to the centrosome, and subsequent poleward microtubule flux. In neurons, microtubule release within the cell body allows their subsequent transport into neuronal processes by microtubule dependent motor proteins. This transport is required for axonal growth.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB

Publications for Katanin p60 Antibody (NBP1-74115) (0)

There are no publications for Katanin p60 Antibody (NBP1-74115).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Katanin p60 Antibody (NBP1-74115) (0)

There are no reviews for Katanin p60 Antibody (NBP1-74115). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for Katanin p60 Antibody (NBP1-74115) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Katanin p60 Antibody Products

Related Products by Gene

Bioinformatics Tool for Katanin p60 Antibody (NBP1-74115)

Discover related pathways, diseases and genes to Katanin p60 Antibody (NBP1-74115). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Katanin p60

There are no specific blogs for Katanin p60, but you can read our latest blog posts.

Contact Information

Product PDFs

Gene Symbol KATNA1

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-74115 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.