KAT3B/p300 Antibody (1D2)

Images

 
Western Blot: KAT3B/p300 Antibody (1D2) [H00002033-M02] - EP300 monoclonal antibody (M02), clone 1D2 Analysis of EP300 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: KAT3B/p300 Antibody (1D2) [H00002033-M02] - Analysis of monoclonal antibody to EP300 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: KAT3B/p300 Antibody (1D2) [H00002033-M02] - Analysis of monoclonal antibody to EP300 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.
Sandwich ELISA: KAT3B/p300 Antibody (1D2) [H00002033-M02] - Detection limit for recombinant GST tagged EP300 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
1D2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

KAT3B/p300 Antibody (1D2) Summary

Immunogen
EP300 (NP_001420 731 a.a. - 830 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQN
Specificity
EP300 - E1A binding protein p300 (1D2)
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
EP300
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Ascites

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KAT3B/p300 Antibody (1D2)

  • E1A binding protein p300
  • E1A-associated protein p300
  • E1A-binding protein, 300kD
  • EC 2.3.1
  • EC 2.3.1.48
  • EP300
  • histone acetyltransferase p300
  • KAT3B
  • p300 HAT
  • p300
  • RSTS2

Background

This gene encodes the adenovirus E1A-associated cellular p300 transcriptional co-activator protein. It functions as histone acetyltransferase that regulates transcription via chromatin remodeling and is important in the processes of cell proliferation and differentiation. It mediates cAMP-gene regulation by binding specifically to phosphorylated CREB protein. This gene has also been identified as a co-activator of HIF1A (hypoxia-inducible factor 1 alpha), and thus plays a role in the stimulation of hypoxia-induced genes such as VEGF. Defects in this gene are a cause of Rubinstein-Taybi syndrome and may also play a role in epithelial cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00008850-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-01264
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13943
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-410
Species: Hu, Mu
Applications: WB, IP

Publications for KAT3B/p300 Antibody (H00002033-M02) (0)

There are no publications for KAT3B/p300 Antibody (H00002033-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KAT3B/p300 Antibody (H00002033-M02) (0)

There are no reviews for KAT3B/p300 Antibody (H00002033-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KAT3B/p300 Antibody (H00002033-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KAT3B/p300 Products

Bioinformatics Tool for KAT3B/p300 Antibody (H00002033-M02)

Discover related pathways, diseases and genes to KAT3B/p300 Antibody (H00002033-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KAT3B/p300 Antibody (H00002033-M02)

Discover more about diseases related to KAT3B/p300 Antibody (H00002033-M02).
 

Pathways for KAT3B/p300 Antibody (H00002033-M02)

View related products by pathway.

PTMs for KAT3B/p300 Antibody (H00002033-M02)

Learn more about PTMs related to KAT3B/p300 Antibody (H00002033-M02).
 

Research Areas for KAT3B/p300 Antibody (H00002033-M02)

Find related products by research area.

Blogs on KAT3B/p300

There are no specific blogs for KAT3B/p300, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KAT3B/p300 Antibody (1D2) and receive a gift card or discount.

Bioinformatics

Gene Symbol EP300
Entrez
OMIM