Kaptin Antibody (1C7)

Images

 
Western Blot: Kaptin Antibody (1C7) [H00011133-M01] - KPTN monoclonal antibody (M01), clone 1C7 Analysis of KPTN expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: Kaptin Antibody (1C7) [H00011133-M01] - Analysis of monoclonal antibody to KPTN on HeLa cell. Antibody concentration 10 ug/ml.
ELISA: Kaptin Antibody (1C7) [H00011133-M01] - Detection limit for recombinant GST tagged KPTN is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1C7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Kaptin Antibody (1C7) Summary

Immunogen
KPTN (AAH09249, 1 a.a. ~ 436 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MMGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVLGFRYQDLRQKIRPVAKELQFNYIPVDAEIVSIDTFNKSPPKRGLVVGITFIKDSGDKGSPFLNIYCDYEPGSEYNLDSIAQSCLNLELQFTPFQLCHAEVQVGDQLETVFLLSGNDPAIHLYKENEGLHQFEEQPVENLFPELTNLTSSVLWLDVHNFPGTSRRLSALGCQSGYVRVAHVDQRSREVLQMWSVLQDGPISRVIVFSLSAAKETKDRPLQDEYSVLVASMLEPAVVYRDLLNRGLEDQLLLPGSDQFDSVLCSLVTDVDLDGRPEVLVATYGQELLCYKYRGPESGLPEAQHGFHLLWQRSFSSPLLAMAHVDLTGDGLQELAVVSLKGVHILQHSLIQASELVLTRLRHQVEQRRRRLQGLEDGAGAGPAENAAS
Specificity
kaptin (actin binding protein)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KPTN
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Kaptin Antibody (1C7)

  • 2E4
  • Actin-associated protein 2E4
  • kaptin (actin binding protein)
  • kaptin (actin-binding protein)
  • kaptin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4470
Species: All-Multi
Applications: WB, IHC, ICC
NBP2-48980
Species: Hu
Applications: IHC, IHC-P
NBP2-00555
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1444
Species: Mu
Applications: WB, IHC
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
MAB39102
Species: Hu
Applications: ICC
NBP2-45683
Species: Hu, Mu, Rt
Applications: WB, IHC
H00011133-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Kaptin Antibody (H00011133-M01) (0)

There are no publications for Kaptin Antibody (H00011133-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kaptin Antibody (H00011133-M01) (0)

There are no reviews for Kaptin Antibody (H00011133-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Kaptin Antibody (H00011133-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Kaptin Products

Bioinformatics Tool for Kaptin Antibody (H00011133-M01)

Discover related pathways, diseases and genes to Kaptin Antibody (H00011133-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kaptin Antibody (H00011133-M01)

Discover more about diseases related to Kaptin Antibody (H00011133-M01).
 

Pathways for Kaptin Antibody (H00011133-M01)

View related products by pathway.

Blogs on Kaptin

There are no specific blogs for Kaptin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kaptin Antibody (1C7) and receive a gift card or discount.

Bioinformatics

Gene Symbol KPTN
Entrez
Uniprot