Recombinant Human Kallikrein 6/Neurosin Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Kallikrein 6/Neurosin Peptides and Proteins

Order Details


    • Catalog Number
      H00005653-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Kallikrein 6/Neurosin Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 91-190 of Human KLK6 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPLERDCSANTTSCHILGWGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNMLCAGDEKYGK

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
KLK6

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00005653-Q01.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Hepes pH 7.5, 100 mM NaCl, 5 mM DTT, 15 mM reduced glutathione, 20% glycerol

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Kallikrein 6/Neurosin Protein

  • Bssp
  • EC 3.4.21
  • EC 3.4.21.-
  • hK6
  • kallikrein 6 (neurosin, zyme)
  • Kallikrein 6
  • kallikrein-6
  • kallikrein-related peptidase 6
  • KLK6
  • Klk7
  • Neurosin
  • Protease M
  • protease, serine, 18
  • PRSS18
  • PRSS9
  • PRSS9MGC9355
  • Serine protease 18
  • Serine protease 9
  • SP59
  • Zyme

Background

KLK6 - kallikrein 6 (neurosin, zyme)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut
MAB1719
Species: Hu
Applications: WB, IHC, ICC
AF2007
Species: Hu
Applications: WB
MAB2337
Species: Hu
Applications: WB, IP
2626-SE
Species: Hu
MAB4104
Species: Hu
Applications: WB, IP, Neut
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2625
Species: Hu
Applications: WB, IHC, IP, Neut
AF2624
Species: Hu, Mu
Applications: WB, IHC, IP
NLS2146
Species: Hu, Bv, Ca, Eq, Mk, Rb
Applications: IHC-P
MAB944
Species: Hu
Applications: WB, IHC
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP1-90509
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Kallikrein 6/Neurosin Partial Recombinant Protein (H00005653-Q01)(1)


Reviews for Kallikrein 6/Neurosin Partial Recombinant Protein (H00005653-Q01) (0)

There are no reviews for Kallikrein 6/Neurosin Partial Recombinant Protein (H00005653-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kallikrein 6/Neurosin Partial Recombinant Protein (H00005653-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kallikrein 6/Neurosin Products

Bioinformatics Tool for Kallikrein 6/Neurosin Partial Recombinant Protein (H00005653-Q01)

Discover related pathways, diseases and genes to Kallikrein 6/Neurosin Partial Recombinant Protein (H00005653-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kallikrein 6/Neurosin Partial Recombinant Protein (H00005653-Q01)

Discover more about diseases related to Kallikrein 6/Neurosin Partial Recombinant Protein (H00005653-Q01).
 

Pathways for Kallikrein 6/Neurosin Partial Recombinant Protein (H00005653-Q01)

View related products by pathway.

PTMs for Kallikrein 6/Neurosin Partial Recombinant Protein (H00005653-Q01)

Learn more about PTMs related to Kallikrein 6/Neurosin Partial Recombinant Protein (H00005653-Q01).
 

Research Areas for Kallikrein 6/Neurosin Partial Recombinant Protein (H00005653-Q01)

Find related products by research area.

Blogs on Kallikrein 6/Neurosin

There are no specific blogs for Kallikrein 6/Neurosin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Kallikrein 6/Neurosin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KLK6
Entrez