Kallikrein 5 Antibody

Images

 
Western Blot: Kallikrein 5 Antibody [H00025818-B01P] - Analysis of KLK5 expression in transfected 293T cell line by KLK5 polyclonal antibody. Lane 1: KLK5 transfected lysate(32.23 KDa). Lane 2: Non-transfected lysate.
Western Blot: Kallikrein 5 Antibody [H00025818-B01P] - Expression in transfected 293T cell line.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Kallikrein 5 Antibody Summary

Immunogen
KLK5 (NP_036559.1, 1 a.a. - 293 a.a.) full-length human protein. MATARPPWMWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
KLK5
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This antibody is useful for Western Blot, Functional

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Kallikrein 5 Antibody

  • EC 3.4.21
  • EC 3.4.21.4
  • Kallikrein 5
  • Kallikrein-like protein 2
  • kallikrein-related peptidase 5
  • KLK5
  • KLKL2
  • KLK-L2
  • KLK-L2EC 3.4.21.-
  • SCTE
  • SCTEkallikrein-5
  • Stratum corneum tryptic enzyme

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2624
Species: Hu, Mu
Applications: IHC, IP, WB
AF2008
Species: Hu
Applications: IHC, IP, WB
MAB35661
Species: Hu
Applications: IHC, IP, Neut, WB
MAB2337
Species: Hu
Applications: IP, WB
2626-SE
Species: Hu
Applications: EnzAct
DKK300
Species: Hu
Applications: ELISA
NBP1-90510
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-75468
Species: Hu, Mu
Applications: IHC, IHC-P, WB
2025-SE
Species: Hu
Applications: EnzAct
H00005655-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF1595
Species: Hu
Applications: IHC, IP, WB
AF2625
Species: Hu
Applications: IHC, IP, Neut, WB
NBP1-06046
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
AF5725
Species: Hu
Applications: IHC
AF2624
Species: Hu, Mu
Applications: IHC, IP, WB
NBP1-88099
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
AF2498
Species: Mu
Applications: IP, WB
1398-TS/CF
Species: Hu
Applications: BA
NB600-930
Species: Hu, Rt
Applications: ELISA, WB
H00025818-B01P
Species: Hu
Applications: WB

Publications for Kallikrein 5 Antibody (H00025818-B01P) (0)

There are no publications for Kallikrein 5 Antibody (H00025818-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kallikrein 5 Antibody (H00025818-B01P) (0)

There are no reviews for Kallikrein 5 Antibody (H00025818-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kallikrein 5 Antibody (H00025818-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kallikrein 5 Products

Bioinformatics Tool for Kallikrein 5 Antibody (H00025818-B01P)

Discover related pathways, diseases and genes to Kallikrein 5 Antibody (H00025818-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kallikrein 5 Antibody (H00025818-B01P)

Discover more about diseases related to Kallikrein 5 Antibody (H00025818-B01P).
 

Pathways for Kallikrein 5 Antibody (H00025818-B01P)

View related products by pathway.

PTMs for Kallikrein 5 Antibody (H00025818-B01P)

Learn more about PTMs related to Kallikrein 5 Antibody (H00025818-B01P).
 

Research Areas for Kallikrein 5 Antibody (H00025818-B01P)

Find related products by research area.

Blogs on Kallikrein 5

There are no specific blogs for Kallikrein 5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kallikrein 5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLK5
Uniprot