Home » Kallikrein 5 » Kallikrein 5 Antibodies » Kallikrein 5 Antibody

Kallikrein 5 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Kallikrein 5 Antibody [H00025818-B01P] - Analysis of KLK5 expression in transfected 293T cell line by KLK5 polyclonal antibody. Lane 1: KLK5 transfected lysate(32.23 KDa). Lane 2: Non-transfected lysate.
Western Blot: Kallikrein 5 Antibody [H00025818-B01P] - Analysis of KLK5 expression in transfected 293T cell line by KLK5 polyclonal antibody. Lane 1: KLK5 transfected lysate(32.23 KDa). Lane 2: Non-transfected lysate.
Western Blot: Kallikrein 5 Antibody [H00025818-B01P] - Expression in transfected 293T cell line.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Kallikrein 5 Antibody Summary

Immunogen
KLK5 (NP_036559.1, 1 a.a. - 293 a.a.) full-length human protein. MATARPPWMWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
KLK5
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This antibody is useful for Western Blot, Functional

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Kallikrein 5 Antibody

  • EC 3.4.21
  • EC 3.4.21.4
  • Kallikrein 5
  • Kallikrein-like protein 2
  • kallikrein-related peptidase 5
  • KLK5
  • KLKL2
  • KLK-L2
  • KLK-L2EC 3.4.21.-
  • SCTE
  • SCTEkallikrein-5
  • Stratum corneum tryptic enzyme

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Kallikrein 7
Antibody [Unconjugate
AF2624
Western blot shows lysates of human skin tissue and mouse skin tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human Kallikrein 7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2624) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Kallikrein 7 at approximately 27-30 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Kallikrein 7 was detected in immersion fixed paraffin-embedded sections of human skin using 1.7 µg/mL Goat Anti-Human Kallikrein 7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2624) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: IHC, IP, WB
Kallikrein
6/Neurosin Antibody
AF2008
Kallikrein 6/Neurosin was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using 15 µg/mL Goat Anti-Human Kallikrein 6/Neurosin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2008) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Reviews)
(4 Publications)
Species: Hu
Applications: IHC, IP, WB
Kallikrein
4/Prostase/EMSP1 Anti ...
MAB35661
Kallikrein 4/Prostase/EMSP1 was detected in immersion fixed paraffin-embedded sections of human prostate using Mouse Anti-Human Kallikrein 4/Prostase/EMSP1 Monoclonal Antibody (Catalog # MAB35661) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counter­stained with hematoxylin (blue). Specific staining was localized to nuclei of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: IHC, IP, Neut, WB
Kallikrein 1
Antibody (323803) [Un ...
MAB2337
Kallikrein 1 Antibody (323803) [Unconjugated]
(1 Review)
Species: Hu
Applications: IP, WB
Kallikrein 14
[Unconjugated]
2626-SE
Recombinant Human Kallikrein 14 (Catalog # 2626‑SE) ismeasured by its ability to cleave the fluorogenic peptide substrate Boc-VPR-AMC (Catalog # ES011).
(1 Review)
(6 Publications)
Species: Hu
Applications: EnzAct
Kallikrein 3/PSA
[HRP]
DKK300
(1 Review)
(15 Publications)
Species: Hu
Applications: ELISA
SPINK5 Antibody
NBP1-90510
Immunohistochemistry-Paraffin: SPINK5 Antibody [NBP1-90510] - Analysis in human tonsil and kidney tissues using Anti-SPINK5 antibody. Corresponding SPINK5 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SPINK5 Antibody [NBP1-90510] - Staining of human kidney shows low expression as expected.
Immunohistochemistry-Paraffin: SPINK5 Antibody [NBP1-90510] - Staining of human tonsil shows high expression.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Desmoglein-1
Antibody (JB19-46)
NBP2-75468
Immunohistochemistry-Paraffin: Desmoglein-1 Antibody (JB19-46) [NBP2-75468] - Analysis of paraffin-embedded human colon cancer tissue using anti-DSG1 antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: Desmoglein-1 Antibody (JB19-46) [NBP2-75468] - Analysis of paraffin-embedded human skin tissue using anti-DSG1 antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: Desmoglein-1 Antibody (JB19-46) [NBP2-75468] - Analysis of paraffin-embedded human uterus tissue using anti-DSG1 antibody. Counter stained with hematoxylin.
(1 Review)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Kallikrein
8/Neuropsin [Unconjug
2025-SE
Kallikrein 8/Neuropsin [Unconjugated]
(5 Publications)
Species: Hu
Applications: EnzAct
Kallikrein 10
Antibody (1G8)
H00005655-M01
Western Blot: Kallikrein 10 Antibody (1G8) [H00005655-M01] - KLK10 monoclonal antibody (M01A), clone 1G8 Analysis of KLK10 expression in A-431.
Immunocytochemistry/Immunofluorescence: Kallikrein 10 Antibody (1G8) [H00005655-M01] - Analysis of monoclonal antibody to KLK10 on A-431 cell. Antibody concentration 10 ug/ml.
ELISA: Kallikrein 10 Antibody (1G8) [H00005655-M01] - Detection limit for recombinant GST tagged KLK10 is approximately 1ng/ml as a capture antibody.
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Kallikrein 11
Antibody [Unconjugate
AF1595
Kallikrein 11 was detected in immersion fixed paraffin-embedded sections of human prostate using Goat Anti-Human Kallikrein 11 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1595) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: IHC, IP, WB
Kallikrein 13
Antibody
AF2625
Kallikrein 13 was detected in immersion fixed paraffin-embedded sections of human prostate cancer tissue using 15 µg/mL Goat Anti-Human Kallikrein 13 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2625) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
Species: Hu
Applications: IHC, IP, Neut, WB
Kallikrein 2
Antibody
NBP1-06046
Western Blot: Kallikrein 2 Antibody [NBP1-06046] - Staining of HeLa cell lysate (A) + peptide (B) (35 ug protein in RIPA buffer). Antibody at 1 ug/mL. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: Kallikrein 2 Antibody [NBP1-06046] - Staining of paraffin embedded Human Prostate. Antibody at 8 ug/mL. Heat induced antigen retrieval with citrate buffer pH 6, HRP-staining.
Immunohistochemistry-Paraffin: Kallikrein 2 Antibody [NBP1-06046] - Negative Control showing staining of paraffin embedded Human Prostate, with no primary antibody.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Corneodesmosin
Antibody [Unconjugate
AF5725
Corneodesmosin was detected in immersion fixed paraffin-embedded sections of human skin using Sheep Anti-Human Corneodesmosin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5725) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(3 Publications)
Species: Hu
Applications: IHC
Kallikrein 7
Antibody [Unconjugate
AF2624
Western blot shows lysates of human skin tissue and mouse skin tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human Kallikrein 7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2624) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Kallikrein 7 at approximately 27-30 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Kallikrein 7 was detected in immersion fixed paraffin-embedded sections of human skin using 1.7 µg/mL Goat Anti-Human Kallikrein 7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2624) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: IHC, IP, WB
Desmocollin-1
Antibody
NBP1-88099
Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human fallopian tube shows very weak membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human prostate shows no membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human skin shows moderate to strong membranous positivity in epidermal cells.
(1 Review)
(3 Publications)
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Plasma
Kallikrein/KLKB1 Anti ...
AF2498
Plasma Kallikrein/KLKB1 Antibody [Unconjugated]
(2 Publications)
Species: Mu
Applications: IP, WB
TSLP
1398-TS/CF
1 μg/lane of Recombinant Human TSLP was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 14 kDa.
Recombinant Human TSLP (Catalog # 1398‑TS/CF) stimulates cell proliferation in the BaF3 mouse pro-B cell line transfected with human IL-7 R alpha and human TSLP R. The ED50 for this effect is 0.05-0.3 ng/mL.
(43 Publications)
Species: Hu
Applications: BA
Plasminogen
Antibody
NB600-930
Western Blot: Plasminogen Antibody [NB600-930] - Detection of Plasminogen under reducing (R) and non-reducing (NR) conditions. Reduced samples of purified target proteins contained 4% BME and were boiled for 5 minutes. Samples of 1ug of protein per lane were run by SDS-PAGE. Protein was transferred to nitrocellulose and probed with 1:3000 dilution of primary antibody. Detection shown was using Dylight 649 conjugated Donkey anti goat 1 hr RT.
Western Blot: Plasminogen Antibody [NB600-930] - Lane 1: Plasminogen. Lane 2: None. Load: 50 ng per lane. Primary antibody: Plasminogen primary antibody at 1:1,000 overnight at 4C. Secondary antibody: Peroxidase goat secondary antibody at 1:40,000 for 60 min at RT. Blocking: incubated with blocking buffer for 30 min at RT. Predicted/Observed size: 91 kDa, 91 kDa for Plasminogen. Other band(s): None.
(2 Reviews)
(7 Publications)
Species: Hu, Rt
Applications: ELISA, WB
Kallikrein 5
Antibody
H00025818-B01P
Kallikrein 5 Antibody
Species: Hu
Applications: WB

Publications for Kallikrein 5 Antibody (H00025818-B01P) (0)

There are no publications for Kallikrein 5 Antibody (H00025818-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kallikrein 5 Antibody (H00025818-B01P) (0)

There are no reviews for Kallikrein 5 Antibody (H00025818-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kallikrein 5 Antibody (H00025818-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kallikrein 5 Products

Bioinformatics Tool for Kallikrein 5 Antibody (H00025818-B01P)

Discover related pathways, diseases and genes to Kallikrein 5 Antibody (H00025818-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kallikrein 5 Antibody (H00025818-B01P)

Discover more about diseases related to Kallikrein 5 Antibody (H00025818-B01P).
 

Pathways for Kallikrein 5 Antibody (H00025818-B01P)

View related products by pathway.

PTMs for Kallikrein 5 Antibody (H00025818-B01P)

Learn more about PTMs related to Kallikrein 5 Antibody (H00025818-B01P).
 

Research Areas for Kallikrein 5 Antibody (H00025818-B01P)

Find related products by research area.

Blogs on Kallikrein 5

There are no specific blogs for Kallikrein 5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kallikrein 5 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol KLK5
Uniprot