Kallikrein 5 Antibody Summary
Immunogen |
KLK5 (NP_036559.1, 1 a.a. - 293 a.a.) full-length human protein. MATARPPWMWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Mouse |
Gene |
KLK5 |
Purity |
Protein G purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:100-1:2000
|
Application Notes |
This antibody is useful for Western Blot, Functional |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Kallikrein 5 Antibody
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC, IP, Neut, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC, IP, Neut, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC
Species: Hu, Mu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Mu
Applications: IP, WB
Species: Hu
Applications: BA
Species: Hu, Rt
Applications: ELISA, WB
Species: Hu
Applications: WB
Publications for Kallikrein 5 Antibody (H00025818-B01P) (0)
There are no publications for Kallikrein 5 Antibody (H00025818-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Kallikrein 5 Antibody (H00025818-B01P) (0)
There are no reviews for Kallikrein 5 Antibody (H00025818-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Kallikrein 5 Antibody (H00025818-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Kallikrein 5 Products
Bioinformatics Tool for Kallikrein 5 Antibody (H00025818-B01P)
Discover related pathways, diseases and genes to Kallikrein 5 Antibody (H00025818-B01P). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Kallikrein 5 Antibody (H00025818-B01P)
Discover more about diseases related to Kallikrein 5 Antibody (H00025818-B01P).
| | Pathways for Kallikrein 5 Antibody (H00025818-B01P)
View related products by pathway.
|
PTMs for Kallikrein 5 Antibody (H00025818-B01P)
Learn more about PTMs related to Kallikrein 5 Antibody (H00025818-B01P).
| | Research Areas for Kallikrein 5 Antibody (H00025818-B01P)
Find related products by research area.
|
Blogs on Kallikrein 5