Recombinant Human Kallikrein 12 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Kallikrein 12 Peptides and Proteins

Order Details


    • Catalog Number
      H00043849-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Kallikrein 12 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-111 of Human KLK12 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGLSIFLLLCVLGLSQAATPKIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDHRWVLTAAHCSGRPIPGSAPVPQPLHRLPCHLPWCVSRENHEQHGVCRRRPGAGCLPG

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
KLK12

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Kallikrein 12 Protein

  • DKFZp686H1078
  • EC 3.4.21
  • EC 3.4.21.-
  • Kallikrein 12
  • Kallikrein-like protein 5
  • kallikrein-related peptidase 12
  • KLK12
  • KLK-L5
  • KLKL5kallikrein-12
  • KLK-L5MGC42603

Background

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Alternate splicing of this gene results in three transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2337
Species: Hu
Applications: WB, IP
AF2008
Species: Hu
Applications: WB, IHC, IP
MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut
AF2625
Species: Hu
Applications: WB, IHC, IP, Neut
2626-SE
Species: Hu
AF1595
Species: Hu
Applications: WB, IHC, IP
AF2007
Species: Hu
Applications: WB
MAB1719
Species: Hu
Applications: WB, IHC, ICC
AF2624
Species: Hu, Mu
Applications: WB, IHC, IP
NBP2-22617
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
MAB4104
Species: Hu
Applications: WB, IP, Neut
NB100-356
Species: Hu, Rb
Applications: WB, Simple Western, B/N, ICC/IF, IHC, IHC-P
27260002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
AF1239
Species: Mu
Applications: WB, IHC, IP
H00043849-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Kallikrein 12 Recombinant Protein (H00043849-P01) (0)

There are no publications for Kallikrein 12 Recombinant Protein (H00043849-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kallikrein 12 Recombinant Protein (H00043849-P01) (0)

There are no reviews for Kallikrein 12 Recombinant Protein (H00043849-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kallikrein 12 Recombinant Protein (H00043849-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kallikrein 12 Products

Bioinformatics Tool for Kallikrein 12 Recombinant Protein (H00043849-P01)

Discover related pathways, diseases and genes to Kallikrein 12 Recombinant Protein (H00043849-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kallikrein 12 Recombinant Protein (H00043849-P01)

Discover more about diseases related to Kallikrein 12 Recombinant Protein (H00043849-P01).
 

Pathways for Kallikrein 12 Recombinant Protein (H00043849-P01)

View related products by pathway.

PTMs for Kallikrein 12 Recombinant Protein (H00043849-P01)

Learn more about PTMs related to Kallikrein 12 Recombinant Protein (H00043849-P01).
 

Research Areas for Kallikrein 12 Recombinant Protein (H00043849-P01)

Find related products by research area.

Blogs on Kallikrein 12

There are no specific blogs for Kallikrein 12, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Kallikrein 12 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KLK12
Entrez