Kallikrein 10 Antibody (1G8)

Images

 
Western Blot: Kallikrein 10 Antibody (1G8) [H00005655-M01A] - KLK10 monoclonal antibody (M01A), clone 1G8 Analysis of KLK10 expression in A-431.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1G8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Kallikrein 10 Antibody (1G8) Summary

Immunogen
KLK10 (NP_002767 167 a.a. - 276 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN
Specificity
KLK10 - kallikrein 10
Isotype
IgG1 Lambda
Clonality
Monoclonal
Host
Mouse
Gene
KLK10
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Ascites
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Kallikrein 10 Antibody (1G8)

  • breast normal epithelial cell associated serine protease
  • EC 3.4.21
  • EC 3.4.21.-
  • EC 3.4.21.74
  • Kallikrein 10
  • kallikrein-related peptidase 10
  • KLK10
  • NES1
  • NES1kallikrein-10
  • Normal epithelial cell-specific 1
  • Protease serine-like 1
  • PRSSL1protease, serine-like, 1

Background

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its encoded protein is secreted and may play a role in suppression of tumorigenesis in breast and prostate cancers. Alternate splicing of this gene results in multiple transcript variants encoding the same protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2008
Species: Hu
Applications: WB, IHC, IP
MAB2337
Species: Hu
Applications: WB, IP
MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4104
Species: Hu
Applications: WB, IP, Neut
AF2624
Species: Hu, Mu
Applications: WB, IHC, IP
MAB1719
Species: Hu
Applications: WB, IHC, ICC
2626-SE
Species: Hu
AF1595
Species: Hu
Applications: WB, IHC, IP
NBP2-38799
Species: Hu
Applications: WB, IHC, IHC-P
AF2625
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-81743
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22617
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
MAB4620
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC

Publications for Kallikrein 10 Antibody (H00005655-M01A) (0)

There are no publications for Kallikrein 10 Antibody (H00005655-M01A).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kallikrein 10 Antibody (H00005655-M01A) (0)

There are no reviews for Kallikrein 10 Antibody (H00005655-M01A). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kallikrein 10 Antibody (H00005655-M01A) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kallikrein 10 Products

Bioinformatics Tool for Kallikrein 10 Antibody (H00005655-M01A)

Discover related pathways, diseases and genes to Kallikrein 10 Antibody (H00005655-M01A). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kallikrein 10 Antibody (H00005655-M01A)

Discover more about diseases related to Kallikrein 10 Antibody (H00005655-M01A).
 

Pathways for Kallikrein 10 Antibody (H00005655-M01A)

View related products by pathway.

PTMs for Kallikrein 10 Antibody (H00005655-M01A)

Learn more about PTMs related to Kallikrein 10 Antibody (H00005655-M01A).
 

Research Areas for Kallikrein 10 Antibody (H00005655-M01A)

Find related products by research area.

Blogs on Kallikrein 10

There are no specific blogs for Kallikrein 10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kallikrein 10 Antibody (1G8) and receive a gift card or discount.

Bioinformatics

Gene Symbol KLK10
Entrez