K0100 Antibody

Images

 
Western Blot: K0100 Antibody [NBP2-85127] - Host: Rabbit. Target Name: KIAA0100. Sample Tissue: Human 293T Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

K0100 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human K0100. Peptide sequence: EVNVVPLTIQLTHQFFHRMMGFFFPGRSVEDDEVGDEEDKSKLVTTGIPV The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (93%), Rat (100%), Canine (100%), Equine (100%), Rabbit (100%), Bovine (100%), Guinea Pig (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
KIAA0100
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for K0100 Antibody

  • Antigen MLAA-22
  • BCOX
  • BCOX1
  • Breast cancer-overexpressed gene 1 protein
  • cancer/testis antigen 101
  • CT101
  • DKFZp686M0843
  • hypothetical protein LOC9703
  • KIAA0100
  • MGC111488
  • MGC134981
  • U937-associated antigen

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF527
Species: Mu
Applications: WB, IHC, Block, ICC
NBP2-38464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-19098
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
H00008731-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-59947
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38172
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-P
NBP2-85127
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb
Applications: WB

Publications for K0100 Antibody (NBP2-85127) (0)

There are no publications for K0100 Antibody (NBP2-85127).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for K0100 Antibody (NBP2-85127) (0)

There are no reviews for K0100 Antibody (NBP2-85127). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for K0100 Antibody (NBP2-85127) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional K0100 Products

Array NBP2-85127

Bioinformatics Tool for K0100 Antibody (NBP2-85127)

Discover related pathways, diseases and genes to K0100 Antibody (NBP2-85127). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for K0100 Antibody (NBP2-85127)

Discover more about diseases related to K0100 Antibody (NBP2-85127).

Blogs on K0100

There are no specific blogs for K0100, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our K0100 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIAA0100