Jun Antibody

Images

 
Western Blot: Jun Antibody [H00003725-B01P] - Analysis of JUN expression in transfected 293T cell line by JUN polyclonal antibody. Lane 1: JUN transfected lysate(36.41 KDa). Lane 2: Non-transfected lysate.
Proximity Ligation Assay: Jun Antibody [H00003725-B01P] - Analysis of protein-protein interactions between GSK3B and JUN. HeLa cells were stained with anti-GSK3B rabbit purified polyclonal 1:1200 and anti-JUN mouse ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, PLA
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Jun Antibody Summary

Immunogen
JUN (AAH68522.1, 1 a.a. - 331 a.a.) full-length human protein. MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
JUN
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Proximity Ligation Assay
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Jun Antibody

  • Activator protein 1
  • AP1
  • AP-1
  • c-Jun
  • enhancer-binding protein AP1
  • Jun activation domain binding protein
  • jun oncogene
  • jun proto-oncogene
  • Proto-oncogene c-Jun
  • transcription factor AP-1
  • V-jun avian sarcoma virus 17 oncogene homologp39
  • v-jun sarcoma virus 17 oncogene homolog (avian)
  • v-jun sarcoma virus 17 oncogene homolog

Background

This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-47757
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
H00003725-B01P
Species: Hu
Applications: WB, PLA

Publications for Jun Antibody (H00003725-B01P) (0)

There are no publications for Jun Antibody (H00003725-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Jun Antibody (H00003725-B01P) (0)

There are no reviews for Jun Antibody (H00003725-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Jun Antibody (H00003725-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Jun Products

Jun H00003725-B01P

Bioinformatics Tool for Jun Antibody (H00003725-B01P)

Discover related pathways, diseases and genes to Jun Antibody (H00003725-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Jun Antibody (H00003725-B01P)

Discover more about diseases related to Jun Antibody (H00003725-B01P).
 

Pathways for Jun Antibody (H00003725-B01P)

View related products by pathway.

PTMs for Jun Antibody (H00003725-B01P)

Learn more about PTMs related to Jun Antibody (H00003725-B01P).
 

Research Areas for Jun Antibody (H00003725-B01P)

Find related products by research area.

Blogs on Jun.

The Link Between Base Excision Repair and Cancer Antibodies
Base excision repair (BER) is the most fundamental DNA repair mechanism, dealing with alterations arising in individual DNA bases during cellular metabolism. We at Novus Biologicals have a large BER antibody database, which has proven important in var...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Jun Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol JUN
Uniprot