JNK3 Antibody


Western Blot: JNK3 Antibody [NBP1-74121] - Lanes: Lane1 : 40 ug tobacco hornworm larvae intestine lysate Lane2: 100 ug tobacco hornworm larvae intestine lysate Primary Antibody Dilution: 1 : 1000 Secondary Antibody: ...read more
Western Blot: JNK3 Antibody [NBP1-74121] - Titration: 1.0 ug/ml Positive Control: Rat Liver.

Product Details

Product Discontinued
View other related JNK3 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

JNK3 Antibody Summary

Synthetic peptides corresponding to the N terminal of Mapk10. Immunizing peptide sequence RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Mapk10 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for JNK3 Antibody

  • c-Jun N-terminal kinase 3
  • EC 2.7.11
  • EC
  • JNK3 alpha protein kinase
  • JNK3
  • JNK3A
  • JNK3FLJ12099
  • MAP kinase 10
  • MAP kinase p49 3F12
  • MAPK 10
  • MAPK10
  • MGC50974
  • mitogen-activated protein kinase 10
  • p493F12
  • p54bSAPK
  • PRKM10FLJ33785
  • SAPK1 beta
  • stress activated protein kinase beta
  • Stress-activated protein kinase JNK3


Mapk10 is a stress-activated protein kinase.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC, KO
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for JNK3 Antibody (NBP1-74121) (0)

There are no publications for JNK3 Antibody (NBP1-74121).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for JNK3 Antibody (NBP1-74121) (0)

There are no reviews for JNK3 Antibody (NBP1-74121). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for JNK3 Antibody (NBP1-74121) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for JNK3 Antibody (NBP1-74121)

Discover related pathways, diseases and genes to JNK3 Antibody (NBP1-74121). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for JNK3 Antibody (NBP1-74121)

Discover more about diseases related to JNK3 Antibody (NBP1-74121).

Pathways for JNK3 Antibody (NBP1-74121)

View related products by pathway.

PTMs for JNK3 Antibody (NBP1-74121)

Learn more about PTMs related to JNK3 Antibody (NBP1-74121).

Blogs on JNK3

There are no specific blogs for JNK3, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our JNK3 Antibody and receive a gift card or discount.


Gene Symbol MAPK10