JNK2 Antibody

Images

 
Western Blot: JNK2 Antibody [NBP1-74122] - Mouse Heart Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Product Discontinued
View other related JNK2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-74122
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

JNK2 Antibody Summary

Immunogen
Synthetic peptides corresponding to the N terminal of Mapk9. Immunizing peptide sequence VCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLL.
Clonality
Polyclonal
Host
Rabbit
Gene
MAPK9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Mapk9 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for JNK2 Antibody

  • c-Jun kinase 2
  • c-Jun N-terminal kinase 2
  • EC 2.7.11
  • EC 2.7.11.24
  • JNK2
  • JNK2A
  • JNK2BETA
  • JNK2JNK2ALPHA
  • JNK-55
  • Jun kinase
  • MAP kinase 9
  • MAPK 9
  • MAPK9
  • mitogen-activated protein kinase 9
  • p54a
  • p54aSAPK
  • PRKM9JNK2B
  • SAPK
  • SAPK1 alpha
  • Stress-activated protein kinase JNK2

Background

Mapk9 responds to activation by environmental stress and pro-inflammatory cytokines by phosphorylating a number of transcription factors, primarily components of AP-1 such as c-Jun and ATF2 and thus regulates AP-1 transcriptional activity. In T-cells, JNK1 and JNK2 are required for polarized differentiation of T-helper cells into Th1 cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-74122
Species: Mu
Applications: WB

Publications for JNK2 Antibody (NBP1-74122) (0)

There are no publications for JNK2 Antibody (NBP1-74122).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for JNK2 Antibody (NBP1-74122) (0)

There are no reviews for JNK2 Antibody (NBP1-74122). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for JNK2 Antibody (NBP1-74122) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional JNK2 Products

Bioinformatics Tool for JNK2 Antibody (NBP1-74122)

Discover related pathways, diseases and genes to JNK2 Antibody (NBP1-74122). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for JNK2 Antibody (NBP1-74122)

Discover more about diseases related to JNK2 Antibody (NBP1-74122).
 

Pathways for JNK2 Antibody (NBP1-74122)

View related products by pathway.

PTMs for JNK2 Antibody (NBP1-74122)

Learn more about PTMs related to JNK2 Antibody (NBP1-74122).

Blogs on JNK2

There are no specific blogs for JNK2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our JNK2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPK9
Entrez
Uniprot