JNK2 Antibody


Western Blot: JNK2 Antibody [NBP1-74122] - Mouse Heart Lysate 1ug/ml Gel Concentration 12%

Product Details

Product Discontinued
View other related JNK2 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

JNK2 Antibody Summary

Synthetic peptides corresponding to the N terminal of Mapk9. Immunizing peptide sequence VCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Mapk9 and was validated on Western blot.
Positive Control
JNK2 Lysate (NBP2-65699)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for JNK2 Antibody

  • c-Jun kinase 2
  • c-Jun N-terminal kinase 2
  • EC 2.7.11
  • EC
  • JNK2
  • JNK2A
  • JNK-55
  • Jun kinase
  • MAP kinase 9
  • MAPK 9
  • MAPK9
  • mitogen-activated protein kinase 9
  • p54a
  • p54aSAPK
  • SAPK
  • SAPK1 alpha
  • Stress-activated protein kinase JNK2


Mapk9 responds to activation by environmental stress and pro-inflammatory cytokines by phosphorylating a number of transcription factors, primarily components of AP-1 such as c-Jun and ATF2 and thus regulates AP-1 transcriptional activity. In T-cells, JNK1 and JNK2 are required for polarized differentiation of T-helper cells into Th1 cells.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ICC, KO
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi

Publications for JNK2 Antibody (NBP1-74122) (0)

There are no publications for JNK2 Antibody (NBP1-74122).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for JNK2 Antibody (NBP1-74122) (0)

There are no reviews for JNK2 Antibody (NBP1-74122). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for JNK2 Antibody (NBP1-74122) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional JNK2 Products

Bioinformatics Tool for JNK2 Antibody (NBP1-74122)

Discover related pathways, diseases and genes to JNK2 Antibody (NBP1-74122). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for JNK2 Antibody (NBP1-74122)

Discover more about diseases related to JNK2 Antibody (NBP1-74122).

Pathways for JNK2 Antibody (NBP1-74122)

View related products by pathway.

PTMs for JNK2 Antibody (NBP1-74122)

Learn more about PTMs related to JNK2 Antibody (NBP1-74122).

Blogs on JNK2

There are no specific blogs for JNK2, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our JNK2 Antibody and receive a gift card or discount.


Gene Symbol MAPK9