JNK2 Antibody (3C12)

Images

 
Western Blot: JNK2 Antibody (3C12) [H00005601-M03] - Analysis of MAPK9 expression in HeLa (Cat # L013V1).
Immunocytochemistry/ Immunofluorescence: JNK2 Antibody (3C12) [H00005601-M03] - Analysis of monoclonal antibody to MAPK9 on HeLa cell. Antibody concentration 10 ug/ml
ELISA: JNK2 Antibody (3C12) [H00005601-M03] - Detection limit for recombinant GST tagged MAPK9 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3C12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

JNK2 Antibody (3C12) Summary

Immunogen
MAPK9 (AAH32539 321 a.a. - 424 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEVMDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPLEGCR
Localization
Nuclear
Specificity
MAPK9 - mitogen-activated protein kinase 9
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MAPK9
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for JNK2 Antibody (3C12)

  • c-Jun kinase 2
  • c-Jun N-terminal kinase 2
  • EC 2.7.11
  • EC 2.7.11.24
  • JNK2
  • JNK2A
  • JNK2BETA
  • JNK2JNK2ALPHA
  • JNK-55
  • Jun kinase
  • MAP kinase 9
  • MAPK 9
  • MAPK9
  • mitogen-activated protein kinase 9
  • p54a
  • p54aSAPK
  • PRKM9JNK2B
  • SAPK
  • SAPK1 alpha
  • Stress-activated protein kinase JNK2

Background

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase targets specific transcription factors, and thus mediates immediate-early gene expression in response to various cell stimuli. It is most closely related to MAPK8, both of which are involved in UV radiation induced apoptosis, thought to be related to the cytochrome c-mediated cell death pathway. This gene and MAPK8 are also known as c-Jun N-terminal kinases. This kinase blocks the ubiquitination of tumor suppressor p53, and thus it increases the stability of p53 in nonstressed cells. Studies of this gene's mouse counterpart suggest a key role in T-cell differentiation. Four alternatively spliced transcript variants encoding distinct isoforms have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
H00005601-M03
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for JNK2 Antibody (H00005601-M03) (0)

There are no publications for JNK2 Antibody (H00005601-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for JNK2 Antibody (H00005601-M03) (0)

There are no reviews for JNK2 Antibody (H00005601-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for JNK2 Antibody (H00005601-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional JNK2 Products

Bioinformatics Tool for JNK2 Antibody (H00005601-M03)

Discover related pathways, diseases and genes to JNK2 Antibody (H00005601-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for JNK2 Antibody (H00005601-M03)

Discover more about diseases related to JNK2 Antibody (H00005601-M03).
 

Pathways for JNK2 Antibody (H00005601-M03)

View related products by pathway.

PTMs for JNK2 Antibody (H00005601-M03)

Learn more about PTMs related to JNK2 Antibody (H00005601-M03).
 

Research Areas for JNK2 Antibody (H00005601-M03)

Find related products by research area.

Blogs on JNK2

There are no specific blogs for JNK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our JNK2 Antibody (3C12) and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPK9
Entrez
OMIM
Uniprot