JNK1 Antibody (1E2.)

Images

 
Proximity Ligation Assay: JNK1 Antibody (1E2) [H00005599-M08] - Analysis of protein-protein interactions between CDC42 and MAPK8. HeLa cells were stained with anti-CDC42 rabbit purified polyclonal 1:1200 and anti-MAPK8 ...read more

Product Details

Summary
Product Discontinued
View other related JNK1 Primary Antibodies

Order Details


    • Catalog Number
      H00005599-M08
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

JNK1 Antibody (1E2.) Summary

Immunogen
MAPK8 (NP_620637 318 a.a. - 427 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEVMDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAAGPLGCCR
Specificity
MAPK8 - mitogen-activated protein kinase 8 (1E2)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MAPK8
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for JNK1 Antibody (1E2.)

  • c-Jun N-terminal kinase 1
  • EC 2.7.11
  • EC 2.7.11.24
  • JNK1 alpha protein kinase
  • JNK1 beta protein kinase
  • JNK1
  • JNK1JNK1A2
  • JNK-46
  • JUN N-terminal kinase
  • MAP kinase 8
  • MAPK 8
  • MAPK8
  • mitogen-activated protein kinase 8 isoform JNK1 alpha1
  • mitogen-activated protein kinase 8 isoform JNK1 beta2
  • mitogen-activated protein kinase 8
  • PRKM8
  • PRKM8JNK
  • protein kinase JNK1
  • SAPK1
  • SAPK1JNK21B1/2
  • Stress-activated protein kinase 1
  • Stress-activated protein kinase JNK1

Background

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various cell stimuli, and targets specific transcription factors, and thus mediates immediate-early gene expression in response to cell stimuli. The activation of this kinase by tumor-necrosis factor alpha (TNF-alpha) is found to be required for TNF-alpha induced apoptosis. This kinase is also involved in UV radiation induced apoptosis, which is thought to be related to cytochrom c-mediated cell death pathway. Studies of the mouse counterpart of this gene suggested that this kinase play a key role in T cell proliferation, apoptosis and differentiation. Four alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
MAB1846
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB5526
Species: Hu, Mu
Applications: WB
H00005599-M08
Species: Hu
Applications: WB, ELISA, PLA

Publications for JNK1 Antibody (H00005599-M08) (0)

There are no publications for JNK1 Antibody (H00005599-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for JNK1 Antibody (H00005599-M08) (0)

There are no reviews for JNK1 Antibody (H00005599-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for JNK1 Antibody (H00005599-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional JNK1 Products

Bioinformatics Tool for JNK1 Antibody (H00005599-M08)

Discover related pathways, diseases and genes to JNK1 Antibody (H00005599-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for JNK1 Antibody (H00005599-M08)

Discover more about diseases related to JNK1 Antibody (H00005599-M08).
 

Pathways for JNK1 Antibody (H00005599-M08)

View related products by pathway.

PTMs for JNK1 Antibody (H00005599-M08)

Learn more about PTMs related to JNK1 Antibody (H00005599-M08).
 

Research Areas for JNK1 Antibody (H00005599-M08)

Find related products by research area.

Blogs on JNK1.

MAPK8/JNK1 - A multifunctional kinase and drug target for cancer therapeutics
The c-Jun N-terminal kinase (JNK) family is a group of regulatory kinases with important functions in cell morphogenesis, inflammation, differentiation, and cell death (1). Aberrant activation of JNK family proteins in cancers has led to interest i...  Read full blog post.

Use Of c-Myc Antibodies In Non-Invasive Cancer Studies
Novus Biologicals specializes in offering top quality antibody reagents to many of the transcription factor proteins that are widely expressed in cancer cells.C-Myc is one of several transcription factor proteins covered by our antibody catalog. Enc...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our JNK1 Antibody (1E2.) and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPK8
Entrez
Uniprot