Recombinant Human JMJD1C Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human JMJD1C Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 2-99 of Human JMJD1C

Source: Wheat Germ

Amino Acid Sequence: IVMNDQVLEPQNVDPSMVQMTFLDDVVHSLLKGENIGITSRRRSRANQNVNAVHSHYTRAQANSPRPAMNSQAAVPKQNTHQQQQQRSIRPNKRKGSD

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
JMJD1C
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human JMJD1C Protein

  • DKFZp761F0118
  • EC 1.14.11
  • EC 1.14.11.-
  • FLJ14374
  • JHDM2C
  • jumonji domain containing 1C
  • Jumonji domain-containing protein 1C
  • KIAA1380TR-interacting protein 8
  • probable JmjC domain-containing histone demethylation protein 2C
  • RP11-10C13.2
  • thyroid hormone receptor interactor 8
  • thyroid receptor interacting protein 8
  • Thyroid receptor-interacting protein 8
  • TRIP8
  • TRIP-8

Background

JMJD1C - jumonji domain containing 1C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49601
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP1-77071
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-40585
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
NBP1-49600
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P
NBP1-83385
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45825
Species: Hu
Applications: WB, IHC
NBP2-03396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77105
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-69368
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-67861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00027130-P02
Species: Hu
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56530
Species: Hu
Applications: WB
NB100-74605
Species: Hu, Mu
Applications: WB, IP
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00221037-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for JMJD1C Partial Recombinant Protein (H00221037-Q01) (0)

There are no publications for JMJD1C Partial Recombinant Protein (H00221037-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for JMJD1C Partial Recombinant Protein (H00221037-Q01) (0)

There are no reviews for JMJD1C Partial Recombinant Protein (H00221037-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for JMJD1C Partial Recombinant Protein (H00221037-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for JMJD1C Partial Recombinant Protein (H00221037-Q01)

Discover related pathways, diseases and genes to JMJD1C Partial Recombinant Protein (H00221037-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for JMJD1C Partial Recombinant Protein (H00221037-Q01)

Discover more about diseases related to JMJD1C Partial Recombinant Protein (H00221037-Q01).
 

Pathways for JMJD1C Partial Recombinant Protein (H00221037-Q01)

View related products by pathway.

PTMs for JMJD1C Partial Recombinant Protein (H00221037-Q01)

Learn more about PTMs related to JMJD1C Partial Recombinant Protein (H00221037-Q01).

Blogs on JMJD1C

There are no specific blogs for JMJD1C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

JMJD1C Antibody
NBP1-77072

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human JMJD1C Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol JMJD1C