Recombinant Human JMJD1C Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human JMJD1C Protein Summary

Description
JMJD1C (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: IVMNDQVLEPQNVDPSMVQMTFLDDVVHSLLKGENIGITSRRRSRANQNVNAVHSHYTRAQANSPRPAMNSQAAVPKQNTHQQQQQRSIRPNKRKGSD
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
JMJD1C

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human JMJD1C Protein

  • DKFZp761F0118
  • EC 1.14.11
  • EC 1.14.11.-
  • FLJ14374
  • JHDM2C
  • jumonji domain containing 1C
  • Jumonji domain-containing protein 1C
  • KIAA1380TR-interacting protein 8
  • probable JmjC domain-containing histone demethylation protein 2C
  • RP11-10C13.2
  • thyroid hormone receptor interactor 8
  • thyroid receptor interacting protein 8
  • Thyroid receptor-interacting protein 8
  • TRIP8
  • TRIP-8

Background

JMJD1C - jumonji domain containing 1C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49601
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP1-77071
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-40585
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
NBP1-49600
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P
NBP1-83385
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45825
Species: Hu
Applications: WB, IHC
NBP2-03396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77105
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00027130-P02
Species: Hu
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
6986-PG/CF
Species: Mu
NB100-74605
Species: Hu, Mu
Applications: WB, IP
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00221037-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for JMJD1C Partial Recombinant Protein (H00221037-Q01) (0)

There are no publications for JMJD1C Partial Recombinant Protein (H00221037-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for JMJD1C Partial Recombinant Protein (H00221037-Q01) (0)

There are no reviews for JMJD1C Partial Recombinant Protein (H00221037-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for JMJD1C Partial Recombinant Protein (H00221037-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional JMJD1C Products

Bioinformatics Tool for JMJD1C Partial Recombinant Protein (H00221037-Q01)

Discover related pathways, diseases and genes to JMJD1C Partial Recombinant Protein (H00221037-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for JMJD1C Partial Recombinant Protein (H00221037-Q01)

Discover more about diseases related to JMJD1C Partial Recombinant Protein (H00221037-Q01).
 

Pathways for JMJD1C Partial Recombinant Protein (H00221037-Q01)

View related products by pathway.

PTMs for JMJD1C Partial Recombinant Protein (H00221037-Q01)

Learn more about PTMs related to JMJD1C Partial Recombinant Protein (H00221037-Q01).

Blogs on JMJD1C

There are no specific blogs for JMJD1C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

JMJD1C Antibody
NBP1-77072
JMJD1C Antibody
NBP1-77072
JMJD1C Antibody
NBP1-77072
GDF-8/Myostatin
6986-PG-025/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human JMJD1C Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol JMJD1C