JDP2 Antibody

Western Blot: JDP2 Antibody [NBP2-85124] - Host: Rabbit. Target Name: JDP2. Sample Tissue: Mouse Brain lysates. Antibody Dilution: 1ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

JDP2 Antibody Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse JDP2. Peptide sequence: PVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: JDP2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for JDP2 Antibody

• Jun dimerization protein 2
• JUNDM2
• progesterone receptor co-activator

Background

JDP2 is a gene which codes for a protein that helps to repress transactivation as well as controlling responses such as apoptosis, tumorigenesis, cell differentiation, and antitumogeneris via the modification of histones along with chromatin assembly and is comprised of 163 amino acids, weighs approximately 19 kDa. Studies have been conducted on diseases and disorders relating to this gene including intracranial aneurysms, keratitis, carcinoma, rhabdomyosarcoma, pancreatitis, leukemia, and skeletal muscle neoplasm. JDP2 has also been shown to have interactions with JUND, JUNB, JUN, PGR, and EEF1G in pathways such as the ATF-2 transcription factor and tacrolimus/cyclosporine pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: JDP2