JAMP Recombinant Protein Antigen

Images

 
There are currently no images for JAMP Protein (NBP1-89906PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

JAMP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human JKAMP.

Source: E.coli

Amino Acid Sequence: LYIRSCRVLMLSDWYTMLYNPSPDYVTTVHCTH

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
JKAMP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-89906.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for JAMP Recombinant Protein Antigen

  • C14orf100
  • chromosome 14 open reading frame 100
  • HSPC213
  • HSPC327
  • JAMPCDA06
  • JNK1/MAPK8-associated membrane protein
  • JNK1-associated membrane protein
  • JNK-associated membrane protein
  • Jun N-terminal kinase 1-associated membrane protein
  • Medulloblastoma antigen MU-MB-50.4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-88309
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-00990
Species: Hu, Mu, Rt, Ca, Pm, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB120-11929
Species: Hu, Mu
Applications: WB, Flow
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NB110-40591
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-43760
Species: Hu
Applications: WB, ICC/IF, IHC-Fr, IHC-P
NBP2-94913
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31001
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92271
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006045-M01
Species: Hu, Mu
Applications: WB, ELISA, RNAi, S-ELISA
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF, S-ELISA
MAB1846
Species: Hu, Mu, Rt
Applications: WB, ICC, KO
AF1107
Species: Mu
Applications: WB, IHC
NBP1-89906PEP
Species: Hu
Applications: AC

Publications for JAMP Protein (NBP1-89906PEP) (0)

There are no publications for JAMP Protein (NBP1-89906PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for JAMP Protein (NBP1-89906PEP) (0)

There are no reviews for JAMP Protein (NBP1-89906PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for JAMP Protein (NBP1-89906PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional JAMP Products

Bioinformatics Tool for JAMP Protein (NBP1-89906PEP)

Discover related pathways, diseases and genes to JAMP Protein (NBP1-89906PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for JAMP Protein (NBP1-89906PEP)

Find related products by research area.

Blogs on JAMP.

JAMP (JNK1/MAPK8 associated membrane protein)
JAMP is a seven-transmembrane protein that is a regulator of JNK/MAPK8 activity in response to various stress stimuli. This regulation is part of a broader collective and coordinated response to clearing misfolded proteins from the ER. JAMP facilit...  Read full blog post.

Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our JAMP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol JKAMP