Jagged 2 Antibody (4G10)

Images

 
Western Blot: Jagged 2 Antibody (4G10) [H00003714-M10] - Analysis of JAG2 expression in K-562 (Cat # L009V1).
ELISA: Jagged 2 Antibody (4G10) [H00003714-M10] - Detection limit for recombinant GST tagged JAG2 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4G10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Jagged 2 Antibody (4G10) Summary

Immunogen
JAG2 (NP_002217, 121 a.a. - 210 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVRCDENYYSAPCNKF
Specificity
JAG2 (4G10)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
JAG2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Jagged 2 Antibody (4G10)

  • HJ2
  • JAG2
  • Jagged 2
  • Jagged2
  • protein jagged-2
  • SER2

Background

The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch gene family encode transmembrane receptors that are critical for various cell fate decisions. The protein encoded by this gene is one of several ligands that activate Notch and related receptors. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-93551
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1190
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
H00004854-M01
Species: Hu
Applications: WB, ELISA
NB120-10874
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
AF1389
Species: Mu
Applications: WB, ICC
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00008209-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF3970
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
MAB8634
Species: Mu
Applications: WB, Simple Western, Flow, IHC
NBP2-41305
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP2-13382
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP2-24669
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp

Publications for Jagged 2 Antibody (H00003714-M10) (0)

There are no publications for Jagged 2 Antibody (H00003714-M10).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Jagged 2 Antibody (H00003714-M10) (0)

There are no reviews for Jagged 2 Antibody (H00003714-M10). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Jagged 2 Antibody (H00003714-M10) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Jagged 2 Products

Bioinformatics Tool for Jagged 2 Antibody (H00003714-M10)

Discover related pathways, diseases and genes to Jagged 2 Antibody (H00003714-M10). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Jagged 2 Antibody (H00003714-M10)

Discover more about diseases related to Jagged 2 Antibody (H00003714-M10).
 

Pathways for Jagged 2 Antibody (H00003714-M10)

View related products by pathway.

PTMs for Jagged 2 Antibody (H00003714-M10)

Learn more about PTMs related to Jagged 2 Antibody (H00003714-M10).
 

Research Areas for Jagged 2 Antibody (H00003714-M10)

Find related products by research area.

Blogs on Jagged 2.

Notch Antibody Proves Metastatic Lung Cancer Has a Jagged Edge
We at Novus Biologicals are one of the leading antibody suppliers for cancer research. In a recent Notch antibody study, the Notch ligand Jagged 2 was found to promote the growth of metastatic lung cancer cells by inhibiting miR-200, which blocks epit...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Jagged 2 Antibody (4G10) and receive a gift card or discount.

Bioinformatics

Gene Symbol JAG2
Entrez
OMIM
Uniprot