Jagged 2 Antibody (1F2)

Images

 

Product Details

Summary
Product Discontinued
View other related Jagged 2 Primary Antibodies

Order Details


    • Catalog Number
      H00003714-M16
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Jagged 2 Antibody (1F2) Summary

Immunogen
JAG2 (NP_002217 869 a.a. - 966 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GRSCWSRGTPFPHGSSWVEDCNSCRCLDGRRDCSKVWCGWKPCLLAGQPEALSAQCPLGQRCLEKAPGQCLRPPCEAWGECGAEEPPSTPCLPRSGHL
Specificity
JAG2 (1F2)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
JAG2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Jagged 2 Antibody (1F2)

  • HJ2
  • JAG2
  • Jagged 2
  • Jagged2
  • protein jagged-2
  • SER2

Background

The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch gene family encode transmembrane receptors that are critical for various cell fate decisions. The protein encoded by this gene is one of several ligands that activate Notch and related receptors. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-93551
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1190
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
H00004854-M01
Species: Hu
Applications: WB, ELISA
NB120-10874
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
AF1389
Species: Mu
Applications: WB, ICC
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00008209-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF3970
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
MAB8634
Species: Mu
Applications: WB, Simple Western, Flow, IHC
NBP2-41305
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP2-13382
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP2-24669
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp

Publications for Jagged 2 Antibody (H00003714-M16) (0)

There are no publications for Jagged 2 Antibody (H00003714-M16).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Jagged 2 Antibody (H00003714-M16) (0)

There are no reviews for Jagged 2 Antibody (H00003714-M16). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Jagged 2 Antibody (H00003714-M16) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Jagged 2 Products

Bioinformatics Tool for Jagged 2 Antibody (H00003714-M16)

Discover related pathways, diseases and genes to Jagged 2 Antibody (H00003714-M16). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Jagged 2 Antibody (H00003714-M16)

Discover more about diseases related to Jagged 2 Antibody (H00003714-M16).
 

Pathways for Jagged 2 Antibody (H00003714-M16)

View related products by pathway.

PTMs for Jagged 2 Antibody (H00003714-M16)

Learn more about PTMs related to Jagged 2 Antibody (H00003714-M16).
 

Research Areas for Jagged 2 Antibody (H00003714-M16)

Find related products by research area.

Blogs on Jagged 2.

Notch Antibody Proves Metastatic Lung Cancer Has a Jagged Edge
We at Novus Biologicals are one of the leading antibody suppliers for cancer research. In a recent Notch antibody study, the Notch ligand Jagged 2 was found to promote the growth of metastatic lung cancer cells by inhibiting miR-200, which blocks epit...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Jagged 2 Antibody (1F2) and receive a gift card or discount.

Bioinformatics

Gene Symbol JAG2
Entrez
OMIM
Uniprot