ITIH1 Antibody


Western Blot: ITIH1 Antibody [NBP1-74208] - Titration: 1.0 ug/ml Positive Control: Mouse Liver.

Product Details

Product Discontinued
View other related ITIH1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ITIH1 Antibody Summary

Synthetic peptides corresponding to the middle region of Itih1. Immunizing peptide sequence LGFGHDLDFSFLEVMSTENNGWAQRIYEDHDATQQLQGFYNQVANPLLTD.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Itih1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ITIH1 Antibody

  • H1P
  • IGHEP1
  • inter-alpha (globulin) inhibitor H1
  • inter-alpha (globulin) inhibitor, H1 polypeptide
  • Inter-alpha-inhibitor heavy chain 1
  • Inter-alpha-trypsin inhibitor complex component III
  • inter-alpha-trypsin inhibitor heavy chain H1
  • ITI heavy chain H1
  • ITIH
  • ITI-HC1
  • MGC126415
  • Serum-derived hyaluronan-associated protein
  • SHAP


Itih1 may act as a carrier of hyaluronan in serum or as a binding protein between hyaluronan and other matrix protein, including those on cell surfaces in tissues to regulate the localization, synthesis and degradation of hyaluronan which are essential to cells undergoing biological processes.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Mu
Applications: WB, IP, Neut
Species: Hu
Applications: Flow, IHC-Fr, IHC-P, Flow-CS, Flow-IC, IF
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB

Publications for ITIH1 Antibody (NBP1-74208) (0)

There are no publications for ITIH1 Antibody (NBP1-74208).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ITIH1 Antibody (NBP1-74208) (0)

There are no reviews for ITIH1 Antibody (NBP1-74208). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ITIH1 Antibody (NBP1-74208) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ITIH1 Products

Bioinformatics Tool for ITIH1 Antibody (NBP1-74208)

Discover related pathways, diseases and genes to ITIH1 Antibody (NBP1-74208). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ITIH1 Antibody (NBP1-74208)

Discover more about diseases related to ITIH1 Antibody (NBP1-74208).

Pathways for ITIH1 Antibody (NBP1-74208)

View related products by pathway.

Blogs on ITIH1

There are no specific blogs for ITIH1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ITIH1 Antibody and receive a gift card or discount.


Gene Symbol ITIH1