Recombinant Human ITCH/AIP4 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related ITCH/AIP4 Peptides and Proteins

Order Details


    • Catalog Number
      H00083737-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human ITCH/AIP4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 92-190 of Human ITCH partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DVLLGTAALDIYETLKSNNMKLEEVVVTLQLGGDKEPTETIGDLSICLDGLQLESEVVTNGETTCSESASQNDDGSRSKDETRVSTNGSDDPEDAGAGE

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
ITCH

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ITCH/AIP4 Protein

  • AIF4
  • AIP4
  • AIP4dJ468O1.1 (atrophin 1 interacting protein 4 (AIP4))
  • atrophin-1 interacting protein 4
  • Atrophin-1-interacting protein 4
  • dJ468O1.1
  • EC 6.3.2
  • EC 6.3.2.-
  • ITCH
  • itchy (mouse homolog) E3 ubiquitin protein ligase
  • itchy E3 ubiquitin protein ligase homolog (mouse)
  • itchy homolog E3 ubiquitin protein ligase
  • NAPP1
  • NAPP1E3 ubiquitin-protein ligase Itchy homolog
  • NFE2-associated polypeptide 1
  • ubiquitin protein ligase ITCH

Background

ITCH - itchy homolog E3 ubiquitin protein ligase (mouse)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP2-27201
Species: Hu, Mu, Rt, Eq, Pm
Applications: WB
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
H00011059-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC

Publications for ITCH/AIP4 Partial Recombinant Protein (H00083737-Q01) (0)

There are no publications for ITCH/AIP4 Partial Recombinant Protein (H00083737-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ITCH/AIP4 Partial Recombinant Protein (H00083737-Q01) (0)

There are no reviews for ITCH/AIP4 Partial Recombinant Protein (H00083737-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ITCH/AIP4 Partial Recombinant Protein (H00083737-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ITCH/AIP4 Products

Bioinformatics Tool for ITCH/AIP4 Partial Recombinant Protein (H00083737-Q01)

Discover related pathways, diseases and genes to ITCH/AIP4 Partial Recombinant Protein (H00083737-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ITCH/AIP4 Partial Recombinant Protein (H00083737-Q01)

Discover more about diseases related to ITCH/AIP4 Partial Recombinant Protein (H00083737-Q01).
 

Pathways for ITCH/AIP4 Partial Recombinant Protein (H00083737-Q01)

View related products by pathway.

PTMs for ITCH/AIP4 Partial Recombinant Protein (H00083737-Q01)

Learn more about PTMs related to ITCH/AIP4 Partial Recombinant Protein (H00083737-Q01).

Blogs on ITCH/AIP4

There are no specific blogs for ITCH/AIP4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ITCH/AIP4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ITCH
Entrez