Isthmin 1, Angiogenesis Inhibitor Antibody

Images

 
Immunohistochemistry: Isthmin 1, Angiogenesis Inhibitor Antibody [NBP2-30670] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts and Leydig cells.

Order Details


    • Catalog Number
      NBP2-30670
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Isthmin 1, Angiogenesis Inhibitor Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TESRTCDRPNCPGIEDTFRTAATEVSLLAGSEEFNATKLFEVDTDSCERWMSCKSEFLKKYMHKVMNDLPSC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ISM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Isthmin 1, Angiogenesis Inhibitor Antibody

  • bA149I18.1
  • C20orf82
  • Chromosome 20 Open Reading Frame 82
  • dJ1077I2.1
  • ISM
  • ISM1
  • Isthmin 1 Homolog (Zebrafish)
  • Isthmin 1 Homolog
  • Isthmin
  • isthmin-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

423-F8/CF
Species: Hu, Mu
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-52193
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF2275
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
H00007024-B01P
Species: Hu, Mu, Rt
Applications: WB
NBP1-82001
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46123
Species: Hu
Applications: WB, IHC, IHC-P, IF
MAB7446
Species: Hu
Applications: Flow, CyTOF-ready
NB100-64852
Species: Hu
Applications: Flow, IHC, IHC-Fr
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1899
Species: Mu
Applications: WB, IHC
NBP1-81245
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-65853
Species: Mu
Applications: Flow, IP
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for Isthmin 1, Angiogenesis Inhibitor Antibody (NBP2-30670) (0)

There are no publications for Isthmin 1, Angiogenesis Inhibitor Antibody (NBP2-30670).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Isthmin 1, Angiogenesis Inhibitor Antibody (NBP2-30670) (0)

There are no reviews for Isthmin 1, Angiogenesis Inhibitor Antibody (NBP2-30670). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Isthmin 1, Angiogenesis Inhibitor Antibody (NBP2-30670) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Bioinformatics Tool for Isthmin 1, Angiogenesis Inhibitor Antibody (NBP2-30670)

Discover related pathways, diseases and genes to Isthmin 1, Angiogenesis Inhibitor Antibody (NBP2-30670). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Isthmin 1, Angiogenesis Inhibitor Antibody (NBP2-30670)

Discover more about diseases related to Isthmin 1, Angiogenesis Inhibitor Antibody (NBP2-30670).
 

Pathways for Isthmin 1, Angiogenesis Inhibitor Antibody (NBP2-30670)

View related products by pathway.

PTMs for Isthmin 1, Angiogenesis Inhibitor Antibody (NBP2-30670)

Learn more about PTMs related to Isthmin 1, Angiogenesis Inhibitor Antibody (NBP2-30670).

Blogs on Isthmin 1, Angiogenesis Inhibitor

There are no specific blogs for Isthmin 1, Angiogenesis Inhibitor, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Isthmin 1, Angiogenesis Inhibitor Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ISM1
Uniprot