Isocitrate Dehydrogenase 1/IDH1 Antibody - BSA Free

Western Blot: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP2-34091] - Analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-IDH1 antibody. Remaining relative intensity is presented. Loading control: anti-PPIB.

Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP2-34091] - Staining of human pancreas shows very weak cytoplasmic positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP2-34091] - Staining of human prostate shows high expression.

Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP2-34091] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.

Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP2-34091] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.

Simple Western: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP2-34091] - Simple Western lane view shows a specific band for Isocitrate Dehydrogenase 1/IDH1 in 0.2 mg/ml of HepG2 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP2-34091] - Electropherogram image of the corresponding Simple Western lane view. Isocitrate Dehydrogenase 1/IDH1 antibody was used at 1:25 dilution on HepG2 lysate(s) respectively.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Isocitrate Dehydrogenase 1/IDH1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQA
• Predicted Species: Mouse (92%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IDH1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Simple Western 1:25
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in HepG2 lysate, separated by Size, antibody dilution of 1:25, apparent MW was 51 kDa.
• Control Peptide:

  Isocitrate Dehydrogenase 1/IDH1 Protein (NBP2-34091PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Isocitrate Dehydrogenase 1/IDH1 Antibody - BSA Free

• Cytosolic NADP-isocitrate dehydrogenase
• EC 1.1.1.42
• IDCD
• IDH
• IDH1
• IDP
• IDPC
• isocitrate dehydrogenase [NADP] cytoplasmic
• isocitrate dehydrogenase 1 (NADP+), soluble
• Isocitrate Dehydrogenase 1
• NADP(+)-specific ICDH
• NADP-dependent isocitrate dehydrogenase, cytosolic
• NADP-dependent isocitrate dehydrogenase, peroxisomal
• Oxalosuccinate decarboxylase
• PICD

Background

Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IDH1
• Uniprot:
  • O75874()