Isocitrate Dehydrogenase 1/IDH1 Antibody


Western Blot: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-54696] - Rabbit HRP Secondary Dilution: 1:5000
Immunohistochemistry: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-54696] - Staining of human Testis. Antibody Concentration: 5 ug/ml.
Western Blot: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-54696] - 721_B tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-54696] - Human Testis Tissue, 5.0ug/ml.
Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-54696] - HEPG2 lysate + Drosophila extract tissue.

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Isocitrate Dehydrogenase 1/IDH1 Antibody Summary

Synthetic peptides corresponding to IDH1(isocitrate dehydrogenase 1 (NADP+), soluble) The peptide sequence was selected from the C terminal of IDH1. Peptide sequence MMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against IDH1 and was validated on Western blot.
Theoretical MW
47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
Isocitrate Dehydrogenase 1/IDH1 Lysate (NBP2-64819)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Isocitrate Dehydrogenase 1/IDH1 Antibody

  • Cytosolic NADP-isocitrate dehydrogenase
  • EC
  • IDCD
  • IDH
  • IDH1
  • IDP
  • IDPC
  • isocitrate dehydrogenase [NADP] cytoplasmic
  • isocitrate dehydrogenase 1 (NADP+), soluble
  • Isocitrate Dehydrogenase 1
  • NADP(+)-specific ICDH
  • NADP-dependent isocitrate dehydrogenase, cytosolic
  • NADP-dependent isocitrate dehydrogenase, peroxisomal
  • Oxalosuccinate decarboxylase
  • PICD


Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+).The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production.Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, ChIP, Flow, ICC/IF, IHC-P, CyTOF-ready, IHC-WhMt
Species: Hu
Applications: IP (-), WB
Species: Hu
Applications: WB, Flow, IHC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-54696) (0)

There are no publications for Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-54696).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-54696) (0)

There are no reviews for Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-54696). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-54696) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Isocitrate Dehydrogenase 1/IDH1 Products

Bioinformatics Tool for Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-54696)

Discover related pathways, diseases and genes to Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-54696). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-54696)

Discover more about diseases related to Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-54696).

Pathways for Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-54696)

View related products by pathway.

PTMs for Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-54696)

Learn more about PTMs related to Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-54696).

Research Areas for Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-54696)

Find related products by research area.

Blogs on Isocitrate Dehydrogenase 1/IDH1

There are no specific blogs for Isocitrate Dehydrogenase 1/IDH1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Isocitrate Dehydrogenase 1/IDH1 Antibody and receive a gift card or discount.


Gene Symbol IDH1