IRX3 Antibody

Images

 
Immunohistochemistry: IRX3 Antibody [NBP2-32363] - Staining of liver cancer.
Immunohistochemistry: IRX3 Antibody [NBP2-32363] - Staining of human small intestine shows moderate cytoplasmic positivity in subset of glandular cells.
Immunohistochemistry: IRX3 Antibody [NBP2-32363] - Staining of liver.

Product Details

Summary
Product Discontinued
View other related IRX3 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-32363
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

IRX3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: FARPAEPEGGTDRCSALEVEKKLLKTAFQPVPRRPQNHLDAALVLSALSS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IRX3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IRX3 Antibody

  • Homeodomain protein IRXB1
  • iroquois homeobox 3
  • Iroquois homeobox protein 3
  • iroquois-class homeodomain protein IRX-1
  • iroquois-class homeodomain protein IRX-3
  • IRX-1
  • IRXB1FLJ99187

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010265-M06
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-83090
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00153572-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-81581
Species: Hu
Applications: IHC, IHC-P
NBL1-12041
Species: Hu
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP1-49672
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82554
Species: Hu
Applications: WB, IHC, IHC-P
NB110-60935
Species: Hu, Mu, Pm
Applications: WB
NBP1-84403
Species: Hu
Applications: IHC, IHC-P
PPS046
Species: Hu, Mu, Rt, Bv, Ca, Ch, GP, Pm, Ze
Applications: WB
AF1979
Species: Hu
Applications: WB, Simple Western, ICC
NB100-1277
Species: Hu, Mu, Ft
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IF, IHC-WhMt
AF475
Species: Mu
Applications: WB, IHC
H00006496-M04
Species: Hu
Applications: WB, ELISA
NB100-55393
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
AF2567
Species: Mu
Applications: WB, IHC
NBP2-32363
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for IRX3 Antibody (NBP2-32363) (0)

There are no publications for IRX3 Antibody (NBP2-32363).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IRX3 Antibody (NBP2-32363) (0)

There are no reviews for IRX3 Antibody (NBP2-32363). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IRX3 Antibody (NBP2-32363) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IRX3 Products

Bioinformatics Tool for IRX3 Antibody (NBP2-32363)

Discover related pathways, diseases and genes to IRX3 Antibody (NBP2-32363). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IRX3 Antibody (NBP2-32363)

Discover more about diseases related to IRX3 Antibody (NBP2-32363).
 

Pathways for IRX3 Antibody (NBP2-32363)

View related products by pathway.

PTMs for IRX3 Antibody (NBP2-32363)

Learn more about PTMs related to IRX3 Antibody (NBP2-32363).

Blogs on IRX3

There are no specific blogs for IRX3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IRX3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IRX3