IRF5 Antibody (1H6) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related IRF5 Primary Antibodies

Order Details


    • Catalog Number
      H00003663-M03PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

IRF5 Antibody (1H6) [PerCP] Summary

Immunogen
IRF5 (NP_002191 395 a.a. - 504 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TPPPFEIFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPWPMHPAGMQ
Specificity
IRF5 - interferon regulatory factor 5
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IRF5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IRF5 Antibody (1H6) [PerCP]

  • IBD14
  • interferon regulatory factor 5
  • IRF5
  • IRF-5
  • SLEB10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00851
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-77263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-31207
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB, Simple Western, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
NBP1-47812
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB3428
Species: Hu
Applications: WB, IHC
NBP2-24906
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC, IF
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00000640-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow
H00007297-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP2-26506
Species: Hu, Mu, Rt
AF8005
Species: Hu
Applications: WB
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for IRF5 Antibody (H00003663-M03PCP) (0)

There are no publications for IRF5 Antibody (H00003663-M03PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IRF5 Antibody (H00003663-M03PCP) (0)

There are no reviews for IRF5 Antibody (H00003663-M03PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IRF5 Antibody (H00003663-M03PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IRF5 Products

Bioinformatics Tool for IRF5 Antibody (H00003663-M03PCP)

Discover related pathways, diseases and genes to IRF5 Antibody (H00003663-M03PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IRF5 Antibody (H00003663-M03PCP)

Discover more about diseases related to IRF5 Antibody (H00003663-M03PCP).
 

Pathways for IRF5 Antibody (H00003663-M03PCP)

View related products by pathway.

PTMs for IRF5 Antibody (H00003663-M03PCP)

Learn more about PTMs related to IRF5 Antibody (H00003663-M03PCP).
 

Research Areas for IRF5 Antibody (H00003663-M03PCP)

Find related products by research area.

Blogs on IRF5

There are no specific blogs for IRF5, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IRF5 Antibody (1H6) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol IRF5
Entrez