IRF2BP1 Antibody

Images

 
Western Blot: IRF2BP1 Antibody [NBP1-74068] - Titration: 1.0 ug/ml Positive Control: Rat Liver.

Product Details

Summary
Product Discontinued
View other related IRF2BP1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-74068
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

IRF2BP1 Antibody Summary

Immunogen
Synthetic peptides corresponding to the N terminal of Irf2bp1. Immunizing peptide sequence ALTLAPGLSPARPLFGSDFEKEKQQRNADCLAELNEAMRGRAEEWHGRPK.
Clonality
Polyclonal
Host
Rabbit
Gene
IRF2BP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Irf2bp1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for IRF2BP1 Antibody

  • DKFZP434M154
  • interferon regulatory factor 2 binding protein 1
  • interferon regulatory factor 2-binding protein 1
  • IRF-2-binding protein 1
  • IRF2BP1
  • IRF-2BP1

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7555
Species: Hu
Applications: WB, Simple Western
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-57521
Species: Hu
Applications: ICC/IF
AF4049
Species: Hu
Applications: WB, Simple Western
NBP1-93674
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80789
Species: Hu
Applications: WB, IHC, IHC-P
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-85457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-01732
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-47859
Species: Hu, Mu, Mk
Applications: WB, ICC/IF
NBP2-31775
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-74068
Species: Rt
Applications: WB

Publications for IRF2BP1 Antibody (NBP1-74068) (0)

There are no publications for IRF2BP1 Antibody (NBP1-74068).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IRF2BP1 Antibody (NBP1-74068) (0)

There are no reviews for IRF2BP1 Antibody (NBP1-74068). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IRF2BP1 Antibody (NBP1-74068) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IRF2BP1 Products

Bioinformatics Tool for IRF2BP1 Antibody (NBP1-74068)

Discover related pathways, diseases and genes to IRF2BP1 Antibody (NBP1-74068). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IRF2BP1 Antibody (NBP1-74068)

Discover more about diseases related to IRF2BP1 Antibody (NBP1-74068).
 

Pathways for IRF2BP1 Antibody (NBP1-74068)

View related products by pathway.

PTMs for IRF2BP1 Antibody (NBP1-74068)

Learn more about PTMs related to IRF2BP1 Antibody (NBP1-74068).

Blogs on IRF2BP1

There are no specific blogs for IRF2BP1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IRF2BP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IRF2BP1
Entrez
Uniprot