IRAK4 Antibody (1F9-A11)

Images

 
There are currently no images for IRAK4 Antibody (H00051135-M02).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1F9-A11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IRAK4 Antibody (1F9-A11) Summary

Immunogen
IRAK4 (AAH13316, 1 a.a. ~ 460 a.a) full length recombinant protein with GST tag.MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKP SGDDRYNQFHIRRFEALLQTGKSPTSELLFDWGTTNCTVGDL VDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITVQQKQMP FCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSF SFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTV AVKKLAAMVDITTEELKQQFDQEIKVMAKCQHENL
Localization
Cell Membrane
Specificity
IRAK4 - interleukin-1 receptor-associated kinase 4
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IRAK4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IRAK4 Antibody (1F9-A11)

  • EC 2.7.11
  • EC 2.7.11.1
  • interleukin-1 receptor-associated kinase 4
  • IPD1
  • IRAK4
  • IRAK-4
  • NY-REN-64
  • REN64
  • Renal carcinoma antigen NY-REN-64

Background

Interleukin-1 receptor (see IL1R; MIM 147810)-associated kinases (e.g., IRAK1; MIM 300283) are important mediators in the signal transduction of Toll-like receptor (TLR, e.g., TLR4; MIM 603030) and IL1R family members, collectively referred to as TIRs. IRAK4 functions in this signal transduction pathway.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56699
Species: Hu, Mu, Rt
Applications: WB, IP
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-26506
Species: Hu, Mu, Rt
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-24906
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC, IF
NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB, Simple Western, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB100-56447
Species: Hu, Mu
Applications: WB
NB120-13810
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
NBP1-76782
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00051135-M02
Species: Hu
Applications: WB, ELISA

Publications for IRAK4 Antibody (H00051135-M02) (0)

There are no publications for IRAK4 Antibody (H00051135-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IRAK4 Antibody (H00051135-M02) (0)

There are no reviews for IRAK4 Antibody (H00051135-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IRAK4 Antibody (H00051135-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IRAK4 Products

Bioinformatics Tool for IRAK4 Antibody (H00051135-M02)

Discover related pathways, diseases and genes to IRAK4 Antibody (H00051135-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IRAK4 Antibody (H00051135-M02)

Discover more about diseases related to IRAK4 Antibody (H00051135-M02).
 

Pathways for IRAK4 Antibody (H00051135-M02)

View related products by pathway.

PTMs for IRAK4 Antibody (H00051135-M02)

Learn more about PTMs related to IRAK4 Antibody (H00051135-M02).
 

Research Areas for IRAK4 Antibody (H00051135-M02)

Find related products by research area.

Blogs on IRAK4.

IRAK4: The "master IRAK" critical for initiating immune responses
IRAK4, also known as Interleukin-1 receptor-associated kinase 4, is a serine/threonine-protein kinase that plays a critical role in initiating innate and adaptive immune responses against foreign pathogens. It activates NF-kappaB in both Toll-like rec...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IRAK4 Antibody (1F9-A11) and receive a gift card or discount.

Bioinformatics

Gene Symbol IRAK4
Entrez
Uniprot