IRAK1BP1 Antibody

Images

 
Western Blot: IRAK1BP1 Antibody [NBP1-89178] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-281
Immunocytochemistry/ Immunofluorescence: IRAK1BP1 Antibody [NBP1-89178] - Staining of human cell line SH-SY5Y shows localization to vesicles.
Immunohistochemistry-Paraffin: IRAK1BP1 Antibody [NBP1-89178] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IRAK1BP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LQKTPPTRVFVELVPWADRSRENNLASGRETLPGLRHPLSSTQAQTATREVQVSGTSEVSAGPDRAQVVVRVSSTKE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IRAK1BP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IRAK1BP1 Protein (NBP1-89178PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IRAK1BP1 Antibody

  • ActA binding protein 3,4921528N06Rik
  • AIP70
  • interleukin-1 receptor-associated kinase 1 binding protein 1
  • interleukin-1 receptor-associated kinase 1-binding protein 1
  • MGC138458
  • MGC138460
  • SIMPL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56699
Species: Hu, Mu, Rt
Applications: WB, IP
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-87760
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF6717
Species: Hu
Applications: WB, ICC
AF3264
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-89178
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for IRAK1BP1 Antibody (NBP1-89178) (0)

There are no publications for IRAK1BP1 Antibody (NBP1-89178).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IRAK1BP1 Antibody (NBP1-89178) (0)

There are no reviews for IRAK1BP1 Antibody (NBP1-89178). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IRAK1BP1 Antibody (NBP1-89178) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IRAK1BP1 Products

Bioinformatics Tool for IRAK1BP1 Antibody (NBP1-89178)

Discover related pathways, diseases and genes to IRAK1BP1 Antibody (NBP1-89178). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IRAK1BP1 Antibody (NBP1-89178)

Discover more about diseases related to IRAK1BP1 Antibody (NBP1-89178).
 

Pathways for IRAK1BP1 Antibody (NBP1-89178)

View related products by pathway.

PTMs for IRAK1BP1 Antibody (NBP1-89178)

Learn more about PTMs related to IRAK1BP1 Antibody (NBP1-89178).
 

Research Areas for IRAK1BP1 Antibody (NBP1-89178)

Find related products by research area.

Blogs on IRAK1BP1

There are no specific blogs for IRAK1BP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IRAK1BP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IRAK1BP1